KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1485Help
Entry
Bcenmc03_1485     CDS       T00669                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcenmc03_1485
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_1485
  Amino acid metabolism
   00310 Lysine degradation
    Bcenmc03_1485
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcenmc03_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1647239..1648519
Genome map
AA seq 426 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAAPAAQPAAATASSSA
AASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALP
EVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK
YKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL
VVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN
PPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagttgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtggccgaccagatcatcgcgacgatcgataccgaa
gcgaaggcaggtgctgccgaagcagcggcaggcgccgccgaagtcaagccggcagccgcg
cctgcagcagcagccgcaccggccgctcagccggcagccgcaacggcatcgagctcggcc
gccgcatcgcctgccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtc
gcaggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggcagcaggcagcgca
ccgaaggctgctccggccgccgcaccggcgaagaccgccgccgcgaagccggcgctgccg
gaagtgaaggtgccggcgtcggcagcgacctggctgaacgaccgtccggaacagcgcgtg
ccgatgtcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaac
gcgatcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaag
tacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttctttgtg
aaggcggccgtccatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaac
gacatcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtcgtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatc
gccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggt
acgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaac
ccgccgcaatcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaac
ggccagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatc
gacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggca
cgcctgctgctcgacctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system