KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1587Help
Entry
Bcenmc03_1587     CDS       T00669                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcenmc03_1587
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcenmc03_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1749774..1750709
Genome map
AA seq 311 aa AA seqDB search
MTATVTGAGRVTVVGSLNMDLVVRAPRLPLPGETLAGHAFAQAAGGKGGNQAVAAARLGA
QVAMIGCVGADAHGAALRAGLEAEGIDCTGLATSASASTGVALIVVDDGSQNAIVIVAGG
NGEVTTDTIAGHEAALAAADVLICQLETPPDTVFAALSAGRRLGRTVVLNPAPAVAPLPD
GWLPLVDYLIPNEVEAAALTGLRVRDPAEAEAAARALQAGGARNVLVTLGARGVLALTAD
GTARHYPAPVVQAVDTTAAGDTFIGGFSARLAAGADVDTAIRFAQRAAALSVTRAGAQPS
IPTRSELADQA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaccgtaacgggcgccggccgcgtgacggtggtcggcagcctcaacatggat
ctcgtcgtgcgggcgccgcggctgccgctgccgggcgaaacgctcgccgggcacgccttc
gcgcaggccgcgggcggcaagggcggcaaccaggccgtcgccgccgcccggctcggcgcg
caggtcgcgatgatcggctgcgtcggcgcggatgcgcacggcgcggcactgcgcgcgggc
ctcgaggccgagggcatcgactgcacggggctcgcgacgagcgcgtcggcgtcgaccggc
gtcgcgctgatcgtcgtcgacgatgggagccagaacgcgatcgtgatcgtcgcgggcggc
aacggcgaggtcacgaccgacacgatcgcggggcacgaggccgcgctggcggcggccgac
gtgctgatctgccagctcgagacgccgccggacacggtgttcgcggcactgtcggccgga
cgccggctcggtcgcacggtggtgctcaatccggccccggccgtcgcgccgctgccggac
ggctggctgccgctcgtcgattacctgatcccgaacgaggtcgaggcggccgcgctgacg
gggctgcgcgtgcgcgatccggcagaagccgaagccgccgcgcgggcgctgcaggccggt
ggcgcgcgcaacgtgctggtgacgctcggcgcacgcggcgtgctcgcgttgacggccgat
ggcaccgcgcggcactatccggcgccggtcgtgcaggcggtcgacacgacggccgctggc
gacaccttcatcggcggcttttccgcacggctcgcggccggcgcggacgtcgacacggcc
atccgcttcgcgcaacgcgcggcggcgctgtcggtcacgcgcgcgggcgctcagccgtcg
attccgacgcgctccgaactggccgatcaggcctga

DBGET integrated database retrieval system