KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1849Help
Entry
Bcenmc03_1849     CDS       T00669                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcenmc03_1849 (recR)
DNA repair and recombination proteins [BR:bcm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcenmc03_1849 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2055103..2055699)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccttgtccgcgctcgtcgaagcgttgcgcgtgctgcccggtgtc
gggccgaaatccgcgcagcgcatggcggttcacctgatgcagcacgaccgcgagggcgcg
gagcggctcggccggtcgttgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaggcgcagatctgcgaggtctgcagcgacgaggagcgtgatccgacg
ttgctgtgcgtcgtcgagacgcctgccgaccagatcatgctcgagcagacgatgacctac
cgcgggctgtatttcgtgctgatgggccgactgagcccgctcgacggaatcggtccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcatccgacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagccaccgcccactacctcggccagacgctc
aaggcgcgcgggctggcggtcacgcgtctggcgcgcggcgtgccggtgggcggcgagctc
gagtacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgtcgcacgatgtaa

DBGET integrated database retrieval system