KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1942Help
Entry
Bcenmc03_1942     CDS       T00669                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bcenmc03_1942
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcenmc03_1942
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bcenmc03_1942
Lipid biosynthesis proteins [BR:bcm01004]
 Fatty acid synthase
  Component type
   Bcenmc03_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2158283..2158951
Genome map
AA seq 222 aa AA seqDB search
MDTTFRWKRRAATAALLGTLLAVTVPARAATAPASGPPVIVVLGDSLSAEYGLPRDTGWV
ALLRQRLTTERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVVVELGSNDALRGVPL
ATTEQNLRDIIASAQRARAKVVLVGMYVPPNYGPDYTQKFHAVYTRLSKDLGVPLVPFLL
AGIENKPEMFQADQMHPAQQAQGVLLDNVWPALKPLLGKPHG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacatttcgctggaaaagacgcgcggcgaccgccgcgctgctgggcaccctg
ctggccgtcaccgtgcccgcgcgcgccgcgacggcgccggcatcgggcccgcccgtgatc
gtcgtgctcggcgacagtctctcggccgaatacggcttgccgcgcgacaccggctgggtg
gcactgctgcggcaacggctcacgaccgagcgaatcgattatagcgtcgcgaacgccagc
gtcagcggcgacaccacgagcggcggccgtgcgcggctgcccgcggtgctgcagcggctc
aagccgtcgatcgtcgtcgtcgaactcggctcgaacgacgcgctgcgcggcgtaccactc
gcgacgaccgagcagaacctgcgcgacatcatcgccagcgcccagcgcgcgcgggcgaag
gtcgtgctggtcggcatgtacgtgccacccaattacggccccgactacacgcagaagttc
cacgcggtctatacgcggctgtcgaaggatctcggcgtgccgctcgtgccattcctgctg
gccggcatcgagaacaagcccgagatgttccaggccgaccagatgcatcccgcgcagcag
gcgcagggcgtcctgctcgacaatgtgtggccggcactgaagccgttgctcggcaagccg
cacggctga

DBGET integrated database retrieval system