KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2051Help
Entry
Bcenmc03_2051     CDS       T00669                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00300  Lysine biosynthesis
bcm01100  Metabolic pathways
bcm01120  Microbial metabolism in diverse environments
bcm01230  Biosynthesis of amino acids
Module
bcm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bcenmc03_2051
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bcenmc03_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACA91212
JGI: Bcenmc032051
UniProt: B1JUG2
Position
1:2280260..2281399
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQIMTERLAALGFECETIASHGVTNLWAVKRGTDGR
DGKLLAFAGHTDVVPTGPLEQWTSPPFIPAHRDGKLYGRGAADMKTSLAAFVVASEEFVA
VHPDHRGTIAFLITSDEEGPATDGTVKVVELLQARGERLDYCIVGEPTSTAELGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDAGNEYFPPTTWQVSNL
HAGTGATNVTPGHADLLFNFRFSTASTVEGLQARVHAILDKHGLEYTLKWSVSGLPFLTP
RGELSGALEHAIRTETGITTELSTTGGTSDGRFIARICPQVIEFGPPNGSIHKIDEHIEV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccctagcccttaccgaacagctgatcgcccgcgcgtccgtgacgcccgac
gaccagcactgccagcagatcatgaccgagcgcctcgccgcgctcggcttcgaatgcgag
accatcgcgtcgcacggcgtgaccaacctgtgggccgtcaagcgcggcaccgacggccgc
gacggcaagctgctcgcgttcgcgggccacaccgacgtcgtgccgaccggcccgctcgaa
cagtggacctcgccgccgttcatccccgcccatcgcgacggcaagctgtacggccgcggc
gcggccgacatgaagacgtcgctcgcggcgttcgtcgtcgcgtccgaggaattcgtcgcg
gtgcatccggaccaccgcggcacgatcgcgttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaggtcgtcgagctgctgcaggcacgcggcgagcggctcgac
tactgcatcgtcggcgaaccgacgtcgacggccgagctcggcgacgtcgtcaagaacggc
cgccgcgggtcgatgtccggcgaactggtcgtcaagggcgtgcaaggccacattgcctat
ccgcacctcgcgaagaacccgatccacctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgccggcaacgaatacttcccgccgaccacctggcaggtgtcgaacctg
cacgccggcaccggcgcgaccaacgtgacccccggccacgccgacctgctgttcaacttc
cgcttctcgaccgcgagcaccgtcgaaggcctgcaggcccgcgtgcacgcgatcctcgac
aagcacggcctcgaatacacgctgaagtggtcggtgagcggcctgccgttcctcacgccg
cgcggcgaactgtcgggcgcgctggaacacgcgatccgcaccgagaccggcatcacgacc
gagctgtcgacgacgggcggcacgtcggacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacggtagcatccacaagatcgacgagcacatcgaggtg
cgcttcgtcgacccgctgaagaacgtgtaccgacgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system