KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2275Help
Entry
Bcenmc03_2275     CDS       T00669                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00051  Fructose and mannose metabolism
bcm00562  Inositol phosphate metabolism
bcm00710  Carbon fixation in photosynthetic organisms
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01230  Biosynthesis of amino acids
Module
bcm_M00002  Glycolysis, core module involving three-carbon compounds
bcm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_2275
   00051 Fructose and mannose metabolism
    Bcenmc03_2275
   00562 Inositol phosphate metabolism
    Bcenmc03_2275
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcenmc03_2275
Enzymes [BR:bcm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcenmc03_2275
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcenmc03_2275
  Exosomal proteins of bladder cancer cells
   Bcenmc03_2275
  Exosomal proteins of melanoma cells
   Bcenmc03_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA91436
JGI: Bcenmc032275
UniProt: B1JVP3
Position
1:complement(2545536..2546291)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGTVAAETSIGVCVPFPYLAQVQAQLGD
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRA
LAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcgggcacggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagctcggcgat
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcacacgagcaaggcgcgttcaccggt
gaggtggcggcggcgatggtggcggagttcggcgcgcggtatgcgatcgtcggtcactcg
gagcgtcgcgcgtatcacggcgaaagcaacgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggccggcctcgtgccggtcgtgtgtgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgtatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcatgcgttcctgcggacgcgtctcgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcaaccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system