KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2275Help
Entry
Bcenmc03_2275     CDS       T00669                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcenmc03_2275 (tpiA)
   01230 Biosynthesis of amino acids
    Bcenmc03_2275 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_2275 (tpiA)
   00051 Fructose and mannose metabolism
    Bcenmc03_2275 (tpiA)
   00562 Inositol phosphate metabolism
    Bcenmc03_2275 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcenmc03_2275 (tpiA)
Enzymes [BR:bcm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcenmc03_2275 (tpiA)
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcenmc03_2275 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bcenmc03_2275 (tpiA)
  Exosomal proteins of melanoma cells
   Bcenmc03_2275 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2545536..2546291)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGTVAAETSIGVCVPFPYLAQVQAQLGD
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRA
LAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcgggcacggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagctcggcgat
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcacacgagcaaggcgcgttcaccggt
gaggtggcggcggcgatggtggcggagttcggcgcgcggtatgcgatcgtcggtcactcg
gagcgtcgcgcgtatcacggcgaaagcaacgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggccggcctcgtgccggtcgtgtgtgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgtatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcatgcgttcctgcggacgcgtctcgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcaaccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system