KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2277Help
Entry
Bcenmc03_2277     CDS       T00669                                 

Definition
polynucleotide phosphorylase/polyadenylase (EC:2.7.7.8)
Orthology
K00962  
polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Purine metabolism
Pyrimidine metabolism
RNA degradation
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcenmc03_2277
   00240 Pyrimidine metabolism
    Bcenmc03_2277
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bcenmc03_2277
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     Bcenmc03_2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2547600..2549747)
Genome map
AA seq 715 aa AA seqDB search
MSMFNKVVKEFQWGQHKVRLETGEVARQASGAVIVDVEDTVVLATVVGAKSAKPGQDFFP
LTVDYLEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYIDNAYVLNPTRDQLKASSLDLV
VAGTERAVLMVESEADQLSEEVMLGAVVFGHEQMQIAIDAIHELVRDGGKPEWDWQPAAK
NEALIARVTELAQNDLLAAYQLRDKQARSAKLKEVYAATSAKLEEDALAAGTVAADKATV
GNVLFDIEAKIVRSQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVK
CLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTEQGVTALQMDIKIQGITKEIMQVALAQAKEGRLHI
LGKMTSAVSGANTQLSEFAPRMITVKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTSSEGMAEAKKRIEQITAEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAAAAQSDTPPQQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttcaacaaggtcgtgaaggaattccagtggggccagcacaaggtgcgcctc
gaaaccggtgaagtcgcccgccaggcgagcggcgccgtgatcgtcgacgtcgaagacacc
gtcgtgctggcaaccgtcgtcggcgcgaagtcggcgaagccgggtcaggatttcttcccg
ttgaccgtcgactacctcgagaagacctactcggccggcaagatcccgggcggcttcttc
cgccgcgaaggccgtccgtcggagcacgagacgctgacgtcgcgcctgatcgaccgtccg
ctgcgcccgctgttcccggaaggcttctacaacgaagtccaggtcgtgatccacgtgctg
tccgtgaacccggaaatcccggccgacatccccgcgctgatcggcgcatcggccgcgctc
gccgtgtcgggcctgccgttcaacggcccggtcggtgccgcacgcgtggcatacatcgac
aacgcatacgtgctgaacccgacgcgtgaccagctcaaggcatcgagcctcgacctcgtc
gtcgcgggtacggagcgcgccgtgctgatggtcgagtcggaagccgaccaactgtcggaa
gaagtgatgctgggcgccgtggtgttcggccacgagcagatgcagatcgcgatcgacgcg
atccacgaactggtgcgcgacggcggcaagcccgagtgggactggcagccggcggcgaag
aacgaggcgctgatcgcacgcgtgaccgagctggcgcagaacgatctgctcgccgcttac
cagctccgcgacaagcaggcgcgttcggcaaagctgaaggaagtctatgcggcaacctcg
gcgaagctcgaggaagacgcgctggcggccggtacggtcgcggccgacaaggccacggtc
ggcaacgtgctgttcgacatcgaagcgaagatcgtccgttcgcagatcctgaacggcgag
ccgcgcatcgacggccgcgacacgcgcaccgtgcgtccgatcgaaatccgcaccggcgtg
ctgccgcgtacccacggctcggcactgttcacgcgcggcgagacgcaggcgctggtcgtc
gcgacgctcggcacgaagggtgacgagcagatcatcgacgcgctcgaaggcgaataccgc
gagcgcttcatgctccactacaacatgcccccgttcgcgaccggcgaaacgggccgcgtc
ggctcgccgaagcgccgcgaaatcggccacggccggctggccaagcgcgcgctggtcaag
tgcctgccgagcgccgacgaattcggctactcgatccgcgtcgtgtcggaaatcaccgag
tcgaacggttcgtcgtcgatggcttcggtatgcggcggctgcctcgcgctgatggacgcc
ggcgtgccgatgaaggcgcacgtcgcgggtatcgcgatgggcctgatcctcgaaggcaac
aagttcgcggtgctgaccgacatcctcggcgacgaagatcacctcggcgacatggacttc
aaggtggccggcacggagcagggcgtgacggcgctgcagatggacatcaagatccagggc
atcacgaaggaaatcatgcaggtcgcgctcgcgcaggcgaaggaaggccgcctgcacatc
ctcggcaagatgacgtcggcggtgtcgggtgcgaacacgcaactgtcggaattcgcgccg
cgcatgatcacggtcaagatcaacccggaaaagatccgcgacgtgatcggcaagggcggt
tcggtgatccgcgcgctgacggaagaaacgggcacgaccatcgacatctcggatgacggc
gtcgtgacgatcgccagcacgagcagcgaaggcatggccgaagcgaagaagcgcatcgag
caaatcacggccgagatcgaagtcggtcaggtgtacgaaggcacggtgctcaagctgctc
gatttcggcgcgatcgtgaatctgctgccgggcaaggatggcctgctgcacatctcggaa
atcgtcaacgagcgcgtgaaggacatcaacgactacctgaaggaaggtcagcaggtgaag
gtcaaggtgatccagacggacgagaagggtcgcgtgcgtctgtcggccaaggcgctgctg
aatgaagcagcggcggcagcgcagtcggatacgccgccgcagcagtaa

DBGET integrated database retrieval system