KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2495Help
Entry
Bcenmc03_2495     CDS       T00669                                 

Definition
short-chain dehydrogenase/reductase SDR
Organism
bcm  Burkholderia cenocepacia MC0-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2789097..2789852)
Genome map
AA seq 251 aa AA seqDB search
MKTSGNTILITGSTSGIGLGLAMRFHKAGNKVIVAGRRKALLEQITTDHPGIEAIELDVA
DAESIVQASELAAARYPDLNVVINNAGIMLSENVLEPESLKAAEESVAINLLGTIRMTYA
FLPQLSRKDDGVIINVSSALAFVPFPIAMTYSATKAAVHAFTEGLRVQLADTSVRVIELA
PPGVRTTLFGQEGDEHAMPLEDFLDETLALLHAEPTPKEIIVERARFLRTAQATGNYDKA
LGMLSAWKAPD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcgggcaacacgatcctcatcaccggctcgacctcaggcatagggctcggt
ctggcgatgcgctttcataaggcgggcaacaaggttatcgtcgcaggccgacgtaaggcg
ctgcttgagcagatcaccaccgatcatccaggtatcgaggccatcgaactcgacgtggcc
gacgccgagtcaatcgtccaggcgagcgagctggcagccgcgcgttaccccgacttgaat
gttgtcatcaacaacgccggcatcatgttgagcgaaaatgttctggagccggagtcgctg
aaggctgcggaagagtcggtcgcgatcaaccttctgggcaccattcgcatgacctatgcg
ttcttgccacagctttcgcggaaagacgatggcgtcatcattaatgtcagttcggcattg
gcgtttgttccgttccctattgccatgacctacagcgccaccaaggcggccgttcacgcg
ttcaccgaaggcttgcgcgttcaactcgccgacacatccgtgcgcgtgatcgagttggcg
ccccctggcgtgcgcaccacgttgttcggtcaggaaggcgacgaacacgccatgcccctc
gaagacttccttgacgagacgctcgctcttttgcatgcagagcccacaccaaaggaaatc
atcgtggaacgcgccagatttctccgtactgcccaggctaccggcaactacgacaaggcc
cttggaatgctctccgcatggaaggccccagactga

DBGET integrated database retrieval system