KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2812Help
Entry
Bcenmc03_2812     CDS       T00669                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00900  Terpenoid backbone biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcenmc03_2812
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bcenmc03_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACA91971
JGI: Bcenmc032812
UniProt: B1JYP8
Position
1:3132349..3133230
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGRVARV
TDVPGVPEESDLVVRAANLLKAHTGTAHGVDVEIDKILPMGAGLGGGSSDAATTLLALNR
LWQLDLPRAELQSLAVKLGADVPFFIFGKNAFAEGIGEELAEVELPTRWFLVVTPRVHVP
TAEIFSDELLTRDTKPVTIADFLAQQTSDAEWPDSFGRNDMQEVVTRKYAEVAQVVKWLY
DVTPARMTGSGASVFAAFHSKHEAEAAKAKLPASWNGAVAESLNEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgcctggcgcccgcgaaactcaacctgttc
ctgcacatcaccggccgtcgtccgaacggctatcacgatctgcagagcgtattccagctg
ctgaactggggcgacacgctgcacttcacgctgcgcgacgacggccgcgtcgcacgcgtc
accgacgtgcccggcgtgcccgaggaaagcgatctcgtcgtgcgcgcggccaacctgctg
aaagcgcatacgggtaccgcgcacggcgtcgacgtcgagatcgacaagatcttgccgatg
ggcgccggcctcggcggcggcagctccgacgcggcgacgacgctgctcgcgctgaaccgc
ctgtggcaactcgatttgccgcgcgccgagcttcagtcgctcgcggtcaaactcggtgcc
gacgtcccgttttttatttttggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtagaattgccgactcgctggttcttggttgtgacgccacgcgttcatgtcccg
accgctgaaatattttcagatgagttgttgacaagagatacgaagcccgtcacaattgct
gactttcttgcacagcaaaccagcgatgcggaatggccagatagcttcggccggaacgat
atgcaggaagttgtaacaaggaagtacgcggaagttgcgcaggtggtcaaatggttgtat
gatgtgacccccgcgaggatgaccggctccggagcaagcgtgtttgcagcgtttcacagc
aagcacgaggcagaagcggcgaaagccaaactgcccgccagttggaatggcgcagttgcc
gagagtctgaacgagcatccgctcttcgctttcgcgtcatga

DBGET integrated database retrieval system