KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2831Help
Entry
Bcenmc03_2831     CDS       T00669                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_2831
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bcenmc03_2831
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcenmc03_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3150480..3152966
Genome map
AA seq 828 aa AA seqDB search
MKRTLPSLIAGLLIAVLSPAAISALPASAAAGATAGSAQAAAAQAASLATQLSNGLALRV
AVDNNHAAAAGVPCADLGADGAACATGRLILQNRGHQAIADGGWKLYLHSIRRLLRIDRP
GFALRRLTGDLYELTPQPGSVRLAPGERIELPFVAEYWLLRYSDVIPRPYVVVDGAPPAV
LRYNDTDNELRYVESLPADAQNNSTGNAPPVAARPDPGRALPSVKRELPLPGTLELRGVE
LALPDLPDAQVAALHERATTLGLDGAGVPVRGFVAPRRLPADIATPGGYRLAIGPRGVLI
EGYDRAGLYYGVQTLYSLAPAGGGPIPAMLVEDAPRFTHRGMHVDLARNFKQPATLRRLI
DQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTEIGSRRCHDPSETRCLLPQLGSGPDNRS
GGGYLTRDDYVALVRYAAARFVQIIPEIDMPAHARAAVVTMEARYRRLHAAGREQEASAY
RLLDPQDTTNLTTVQFYDRRSDLNPCVPGALNFASKVIREIAAMHADAQAPLQTWHYGGD
EAKNIFLGGGFQALNGTDPNKGRIDLAAQDKPWARSPACTALLQRGEIKSIDELPTRFAK
QVSAAVNANGIGTMAAWQDGIKHANGPQDFSTRHVMVSLWDTIFWGASDSARDLSGKGYQ
TVLALPDYLYFDFPYTLNPRERGYYWGSHATDEYKVFSLAPENLPQNAEVMGDRDGNPFE
VTGTGPAPRIEGMQGQAWGEVMRNDTFLEYMTYPRLLALAERAWHRADWELPYAAGMRFK
RGDTHHVDIAALQRDWAGFATLLTQRELPKLERAGVGYRKPTFTLTNP
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgtaccttgccatccctcattgccggcctgttgatcgcggtgctgtcgccggct
gcgatctcggcgctgccagcgtcggccgccgctggcgcgaccgccggcagcgcgcaagcg
gccgccgcacaagcagccagcctcgcgacgcagctgtcgaacggcctcgcgttgcgcgtc
gccgtggacaacaaccacgcggccgcggccggcgtgccgtgcgccgatctcggcgccgac
ggcgcggcctgcgcgaccggccgcctgatcctgcagaaccgcggccaccaggcgatcgcc
gacggcggctggaagctctacctgcacagcatccgccgcctgctgcggatcgaccggccc
ggcttcgcgctgcggcggctcaccggcgacctgtacgaactgacgccgcagccgggctcg
gtgcgactcgcgcccggcgagcgcatcgagctgccgttcgtcgccgaatactggctgctg
cgttacagcgacgtgattccgcgtccgtacgtcgtcgtcgacggcgcgccgccggccgtg
ctgcgctacaacgacaccgacaacgagctgcgctacgtcgaatcgctgccggccgacgcg
cagaacaactcgaccggcaacgcgccgccggtggccgcacgacccgatccgggccgcgcg
ctgccgagcgtgaagcgcgaactgccgctgccgggcacgctcgagctgcgcggcgtcgaa
ctcgcgctgccggatctgccggacgcgcaggtcgcggcgctgcacgagcgcgcgacgacc
ctcgggctcgacggcgctggcgtgccggtgcgcggcttcgtcgcgccgcgccggctgccg
gccgacatcgcgacaccgggcggctatcggctcgcgatcgggccgcgcggcgtgctgatc
gaaggctacgatcgcgcgggcctctactacggcgtgcagacgctctactcgctcgcgccg
gccggcggcggcccgatcccggcgatgctcgtcgaggatgcgccgcgcttcacgcatcgc
ggcatgcacgtcgacctcgcgcgcaacttcaagcagccggcgacgctgcgccgcctgatc
gaccagatgagcgcgtacaagctcaatcgcctgcacctgcatctgtccgacgacgaaggc
tggcgcatcgagattccgggcctgcccgagctgaccgagatcggctcgcgccgctgccac
gacccgagcgagacgcgctgcctgctgccgcaactcggctccggccccgacaaccgctcg
ggcggcggctacctgacgcgcgacgactacgtggcgctcgtgcgctacgcggccgcgcgc
ttcgtgcagatcatccccgagatcgacatgcccgcgcatgcgcgcgcggccgtcgtgacg
atggaggcgcgctaccggcggctgcatgcggcgggccgcgagcaggaggcgagcgcgtac
cggctgctcgacccgcaggacacgacgaacctgacgacggtgcagttctacgaccggcgc
agcgacctgaatccatgcgtgccgggcgcgctcaacttcgcatcgaaggtgatccgcgag
atcgcggcgatgcacgcggacgcgcaggcgccgctgcaaacctggcactacggcggcgac
gaagcgaagaacatcttcctcggcggcggcttccaggcactgaacggcaccgatccgaac
aaggggcgcatcgatctcgccgcgcaggacaagccgtgggcacggtcgcccgcttgcacg
gcgctgctccagcgcggcgagatcaagtcgatcgacgagctgccgacgcgtttcgcgaaa
caggtgagcgcggcggtcaacgcgaacgggatcggcacgatggccgcgtggcaggacggc
atcaagcatgcgaacgggccgcaggatttcagcacgcgccacgtgatggtgtcgctgtgg
gacacgatcttctggggcgcgtcggacagcgcgcgcgacctgagcggcaagggctaccag
acggtgctcgcgctgcccgactacctgtacttcgacttcccgtacacgctcaatccgcgc
gagcgcggctactactggggctcgcacgcgaccgacgagtacaaggtgttctcgctcgcg
ccggagaacctgccgcagaacgccgaagtgatgggcgaccgcgacggcaacccgttcgag
gtgacgggcacgggccccgcgccgcgcatcgagggcatgcagggccaggcatggggcgag
gtgatgcgcaacgacaccttcctcgaatacatgacctatccgcggctgctcgcgctggcc
gagcgcgcgtggcaccgggccgactgggagctgccgtatgcggccggcatgcgcttcaag
cgcggcgacacgcatcatgtcgacatcgccgcgctgcagcgcgactgggccggcttcgcg
acgctgctcacgcaacgcgaattgccgaagctggagcgcgccggggtcggctaccggaag
ccgaccttcacgctgacgaatccgtga

DBGET integrated database retrieval system