KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2868Help
Entry
Bcenmc03_2868     CDS       T00669                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00260  Glycine, serine and threonine metabolism
bcm00680  Methane metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01230  Biosynthesis of amino acids
Module
bcm_M00002  Glycolysis, core module involving three-carbon compounds
bcm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_2868
  Energy metabolism
   00680 Methane metabolism
    Bcenmc03_2868
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcenmc03_2868
Enzymes [BR:bcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcenmc03_2868
Membrane trafficking [BR:bcm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bcenmc03_2868
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcenmc03_2868
  Exosomal proteins of melanoma cells
   Bcenmc03_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACA92027
JGI: Bcenmc032868
UniProt: B1JZ61
Position
1:3189539..3190285
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRAGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDENLKPIKHYYLGDQDAIAQAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccaggccggc
gaactgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgccggtcgtc
cactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaaggcggaa
acggccgccaagttcggcgacgagcaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccgttcaacgacccgcgctacgcgaag
gtgccgcgcgagcaactgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgatcgcgccggccgtgcgcgccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatctcggacagcgac
atcgtcggcctgaacatcccgaacggcgtaccgctcgtctatgagctcgacgaaaacctg
aagccgatcaagcactattacctcggcgaccaggacgcgatcgcgcaggcgcaggccgcc
gtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system