KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2868Help
Entry
Bcenmc03_2868     CDS       T00669                                 

Definition
(GenBank) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcenmc03_2868
   01230 Biosynthesis of amino acids
    Bcenmc03_2868
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_2868
  Energy metabolism
   00680 Methane metabolism
    Bcenmc03_2868
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcenmc03_2868
Enzymes [BR:bcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcenmc03_2868
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcenmc03_2868
  Exosomal proteins of melanoma cells
   Bcenmc03_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:3189539..3190285
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRAGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDENLKPIKHYYLGDQDAIAQAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccaggccggc
gaactgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgccggtcgtc
cactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaaggcggaa
acggccgccaagttcggcgacgagcaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccgttcaacgacccgcgctacgcgaag
gtgccgcgcgagcaactgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgatcgcgccggccgtgcgcgccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatctcggacagcgac
atcgtcggcctgaacatcccgaacggcgtaccgctcgtctatgagctcgacgaaaacctg
aagccgatcaagcactattacctcggcgaccaggacgcgatcgcgcaggcgcaggccgcc
gtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system