KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2947Help
Entry
Bcenmc03_2947     CDS       T00669                                 

Definition
8-amino-7-oxononanoate synthase (EC:2.3.1.47)
Orthology
K00652  
8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bcenmc03_2947
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Bcenmc03_2947
Amino acid related enzymes [BR:bcm01007]
 Aminotransferase (transaminase)
  Class II
   Bcenmc03_2947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3280108..3281328
Genome map
AA seq 406 aa AA seqDB search
MSLLDTLQRGLADLDAQGLRRVRRIAYTACDAHMTVNGREIVGFASNDYLGLAAHPALVA
AFAEGAQRYGSGSGGSHLLGGHSRAHARLEDELAGFAGGFSDAPRALYFSTGYMANLAAM
TALAGKGATIFSDALNHASLIDGMRLSRANVQVYPHADTAALAALLDASAAETKLIVSDT
VFSMDGDIAPLTELVALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTL
GKAAGVAGAFVIAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAH
LAALIERTRALLRNTRWQPVDSHTAVQPLVIGSNDATLAAMRALDAHGLWVPAIRPPTVP
AGTSRLRVSLSAAHSFDDLARLEAALIEASEAAAASVGAARQEAAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgacaccctgcaacgcggcctcgccgacctcgacgcgcaagggctgcgc
cgcgtgcgccgcatcgcctacaccgcgtgcgacgcgcacatgaccgtgaacggccgcgaa
atcgtcggcttcgcgagcaacgactacctcggcctcgccgcgcatccggcgctcgtcgcc
gcgttcgcggaaggcgcgcagcgctacggctccggcagcggcggctcgcacctgctcggc
ggccattcgcgcgcgcacgccagactggaggacgaactcgcgggcttcgcgggcggcttc
tccgatgcgccgcgcgcgctgtacttcagcaccggctacatggcgaacctcgccgcgatg
acggcgctcgccggcaagggcgcgacgatcttctccgatgcgctgaaccacgcgtcgctg
atcgacggcatgcggctgtcgcgcgcgaacgtgcaggtctatccgcacgccgatacggcc
gcgctcgccgcgctgctcgacgcatcggcggccgaaacgaagctgatcgtcagcgacacc
gtgttcagcatggacggcgacatcgcgccgctcaccgagctcgtcgcgctggccgaacgc
cacggcgcgtggctcgtcgtcgacgacgcgcacggcttcggcgtgctcggcccgcagggt
cgcggcgcactcgcggccgccgcgctgcgttcgccgcatctcgtgtacgtcggtacgctc
ggcaaggcggccggcgtcgcgggcgcgttcgtgatcgcgcatgaaaccgtgatcgaatgg
ctgatccagcgcgcgcgcagctacatcttcacgaccgccgcgccgccggccgtcgcgcat
gccgtgtcggcgagcctgaaggtgatcgcgggcgacgaaggcgacgcgcgacgcgcgcac
ctcgccgcgctgatcgaacgcacgcgcgcgctgctgcgcaacacgcgctggcagccggtc
gattcgcataccgccgtgcagccgctcgtgatcggcagcaacgatgcgacgcttgcggcg
atgcgcgcgctcgacgcgcacggcctgtgggtgcccgcgatccggccgccgacggtgccg
gccggcacgtcgcggctgcgcgtgtcgctgtcggccgcgcattcgttcgacgatctcgcc
aggctcgaagccgcgttgatcgaggccagcgaggcggccgcggcctccgttggagcggcc
cggcaggaggcggcagcatga

DBGET integrated database retrieval system