KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3398Help
Entry
Bcenmc03_3398     CDS       T00669                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bcm00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:251661..253346
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaactttaccgaatcacgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgatctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaagggtatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgctggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtggcctcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaatgccgcgatcgtgctcgccgcgagccgtggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggttggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccacgcggaaacg
ggcgagctcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaatcagagcgtgcgtgacttcgcc
ctctgctcggcggccgacgaccgcggcctgttcggccagaaaacctacctgcaacgcgtg
tcgagcgacgtcgcggcaggcaccccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgcgggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgtcctgatttc
gacacgctcgacattccgtcgctgctgaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggtcactggcgcggcgtcaacgatctggaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtcggaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system