KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3517Help
Entry
Bcenmc03_3517     CDS       T00669                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcenmc03_3517
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_3517
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_3517
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcenmc03_3517
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcenmc03_3517
   00626 Naphthalene degradation
    Bcenmc03_3517
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcenmc03_3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(393539..394696)
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTQIVEFGAARRLGALLRERFPALVRLCVVTDAFLHRSGVLAPALESLAAH
GWQVTVIDDVIADPPEHVVLEATARAVAADAEIVLGLGGGSSMDVAKLIAVLAPGQQALA
DMYGVDKVASARLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLATHALTLLSRNLLPACDDGRNRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAPAAAP
LYAEMAAIVAPSATGSDEAKTHALIAEIDRLIVATGIPRTLREVGIGEADLPRMASDAML
QTRLLVNNPREVTEADALKIYRQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgtaccgttccgacccagatcgtcgaattcggcgccgcgcgc
cggctcggcgcgctgttgcgcgaacgctttccggcgctcgtgcggctgtgcgtcgtcacc
gatgcgttcctgcatcgcagcggcgtgcttgcgcccgcgctggagagcctcgccgcgcac
ggctggcaggtcaccgtgatcgacgacgtgatcgccgatccgcccgagcacgtggtgctc
gaagccaccgcgcgggccgtcgcggccgatgccgagatcgtgctcgggctcggcggcggc
tcgtcgatggacgtcgcgaagctgatcgcggtgctcgcgccggggcagcaggcgctggcc
gacatgtacggcgtcgacaaggtcgcgagcgcgcggctgccgctcgtgcagatgccgacc
acggccggcacgggctccgaggtcacggccgtgtcgatcgtcacggtcggcgaggcgcgc
aagatgggggtcgtgtcgccgcatctgttcgcggacgtcgcgatcctcgacgcggaactc
acgctcggcctgccgcgcgcggcgacggccgccaccggcatcgacgcgatggtgcatgcg
atcgaggcgtacacgtccgcgcggctgaagaatccggtgtccgacatgctggccacgcac
gcgctgacgctgctgtcgcgcaacctgctgcccgcctgcgacgacggccggaaccggcac
gcgcgcgaagcgatgctggtcggcgcgatgttcgcggggcaggcgttcgcgaatgcgccg
gtcgcggccgtgcacgcgctggcctatccggtcggcgggatcttccacgtgccgcacggg
ttgtcgaatgcgctggtgctgccgcacgtgctgcgcttcaatgcaccggccgccgccccg
ctgtatgcggaaatggcggccatcgtcgcgccgtcggccacgggcagcgacgaagcgaaa
acgcacgcgctgatcgcggagatcgaccggctgatcgtcgcgacgggcattccgcgcacg
ttgcgcgaggtcggtatcggcgaggccgacctgccgaggatggcgtcggacgcgatgctg
cagacgcgcctgctcgtgaacaatccgcgcgaggtgaccgaggccgacgcgctaaagatt
taccggcaggcatggtga

DBGET integrated database retrieval system