KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3552Help
Entry
Bcenmc03_3552     CDS       T00669                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00040  Pentose and glucuronate interconversions
bcm00052  Galactose metabolism
bcm00500  Starch and sucrose metabolism
bcm00520  Amino sugar and nucleotide sugar metabolism
bcm01100  Metabolic pathways
bcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcenmc03_3552
   00052 Galactose metabolism
    Bcenmc03_3552
   00500 Starch and sucrose metabolism
    Bcenmc03_3552
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_3552
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcenmc03_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACA92704
JGI: Bcenmc033552
UniProt: B1K350
Position
2:complement(430228..431115)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgttgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcgtacgagatcgaggccgagctcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtcaattgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgggaatgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaggatgcgccgtcg
aatctcggtgtggtcggccgctacgtgttcatgccgacgatcttcgatcacctgcgcaag
ctcaagccgggcgcgggcggcgaactgcagctcacggatgccgtccagtcgctgctcgcg
aacgaacaggtgctcgcgtatcgctactacggcacgcgtttcgactgcggcagcaagatc
ggttatctgaaggccaccgtcgagctcgcgctccagcatccggaagtgagccgtgaattc
gaggcgtacctgcgtacctgcttgcccgcgctggctgccgtcgcttaa

DBGET integrated database retrieval system