KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3593Help
Entry
Bcenmc03_3593     CDS       T00669                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00020  Citrate cycle (TCA cycle)
bcm00190  Oxidative phosphorylation
bcm00650  Butanoate metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Module
bcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_3593
   00650 Butanoate metabolism
    Bcenmc03_3593
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcenmc03_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACA92745
JGI: Bcenmc033593
UniProt: B1K391
Position
2:complement(478693..479061)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFA
AQWMKLATFVMLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcacactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgatttttcgtacgaaggctgggcatcgatcttcgcc
gcgcaatggatgaagctcgcgaccttcgtgatgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system