KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3747Help
Entry
Bcenmc03_3747     CDS       T00669                                 

Definition
aromatic-ring-hydroxylating dioxygenase subunit beta
Orthology
K16320  
anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bcm00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(658539..659015)
Genome map
AA seq 158 aa AA seqDB search
MTEDMKTWFEIYMLQNRYIGHLDNDRLEHWPEMFTEDCTYEIVPKENADLGLPVGIVHCT
NQRMLRDRVVSLRHANIYEEHTYRHMTSGLTIVAERDGEIDTESNYVVVQTRSNGESNVY
QAGKYYDTVVRTPDGLRYKTKRVIYDTSRVQTLLATPI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagacatgaagacgtggttcgagatttacatgctccagaaccgctacatcggg
cacctcgacaacgaccggctcgaacactggccggagatgttcaccgaggactgcacgtac
gagatcgtgccgaaggagaacgccgatctcgggctgccggtcgggatcgtccactgcacg
aaccagcggatgctgcgcgaccgcgtggtgtcgctgcggcacgcgaacatctatgaagag
cacacgtaccggcacatgacgtcgggcctgacgatcgtcgccgaacgcgacggtgaaatc
gataccgagagcaactacgtggtcgtgcagacgcgcagcaacggcgaatcgaacgtgtac
caggccggcaagtactacgacacggtcgtgcgcacgcccgacggcttgcgctacaagacc
aagcgcgtgatctacgacacgtcgcgcgtgcagacgctgctcgcgacgccgatctga

DBGET integrated database retrieval system