KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3747Help
Entry
Bcenmc03_3747     CDS       T00669                                 

Definition
aromatic-ring-hydroxylating dioxygenase subunit beta
Orthology
K16320  
anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Module
Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcenmc03_3747
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     Bcenmc03_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(658539..659015)
Genome map
AA seq 158 aa AA seqDB search
MTEDMKTWFEIYMLQNRYIGHLDNDRLEHWPEMFTEDCTYEIVPKENADLGLPVGIVHCT
NQRMLRDRVVSLRHANIYEEHTYRHMTSGLTIVAERDGEIDTESNYVVVQTRSNGESNVY
QAGKYYDTVVRTPDGLRYKTKRVIYDTSRVQTLLATPI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagacatgaagacgtggttcgagatttacatgctccagaaccgctacatcggg
cacctcgacaacgaccggctcgaacactggccggagatgttcaccgaggactgcacgtac
gagatcgtgccgaaggagaacgccgatctcgggctgccggtcgggatcgtccactgcacg
aaccagcggatgctgcgcgaccgcgtggtgtcgctgcggcacgcgaacatctatgaagag
cacacgtaccggcacatgacgtcgggcctgacgatcgtcgccgaacgcgacggtgaaatc
gataccgagagcaactacgtggtcgtgcagacgcgcagcaacggcgaatcgaacgtgtac
caggccggcaagtactacgacacggtcgtgcgcacgcccgacggcttgcgctacaagacc
aagcgcgtgatctacgacacgtcgcgcgtgcagacgctgctcgcgacgccgatctga

DBGET integrated database retrieval system