KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4093Help
Entry
Bcenmc03_4093     CDS       T00669                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcenmc03_4093
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_4093
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_4093
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcenmc03_4093
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcenmc03_4093
   00626 Naphthalene degradation
    Bcenmc03_4093
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcenmc03_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1033515..1034594
Genome map
AA seq 359 aa AA seqDB search
MKAAILKSLGQPLAIETLPDPVLGTGEVVVDVVATPVLSYAREVFSGERRYPIKLPMVPG
CGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQGWSARGEGGKQLQRYFR
DGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLLASDLRAGEILLVSGATG
NFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTVGLTGDETADRIRMQQAAP
GPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGMLGGAGLELPYPWIMRNDITL
RGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDANDAVVHAAEHGGPFRMTVIVP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcctgaagtcgctcggccagccgctcgcgatcgaaacgctgccggac
cccgtgctcggcaccggcgaagtcgtcgtggacgtcgtcgcgacaccggttctgtcctat
gcgcgggaagtgttcagcggcgagcgccgctatccgatcaagttgccgatggtgccgggc
tgcggcgcgatcggccgggtccggcaaaccggccccgacgcgacgcaattgcagccgggc
gactgggtgttctgcgacccgaccgtgcgctcgcgcgacgatgcgcggatgcccgacatc
gtgctgcagggctggagtgcgcgcggcgaaggcggcaagcagttgcagcgctattttcgc
gacggcccgttcgccgagcggctgcgcgtgccgaccgagaacgcggtgcgcatcggcgcg
atcgcgccggccgacgccgcgcgctggtgcgcgctcaatacgctgctcgtgccttacggc
ggcctgcttgcgtccgacctgcgcgccggcgaaatcctgctcgtcagcggcgcgaccggc
aatttcggcagcgcctgcatcgcggtggcgctggcgatgggcgcgcaatgcgtggtcgcg
cccggccgcaatgcacgcgtgctggcggagctcgaacgccgcttcggcgagcgcgtgcgc
acggtcgggctgaccggcgacgaaaccgcggaccgcatccgcatgcagcaggcggcgccg
gggccgatcgactgcgtgatcgacctgatgccgccgtcggtgccggcgacgacggtgcgt
gccgccgtgatggccgtgcgtccttatggacgcgtggtgctgatgggcggcgtcggcatg
ctcggcggagccgggctcgagctgccgtatccgtggatcatgcgcaacgacatcacgctg
cgcggcaaatggatgtatccgacggaagccgtgacgctgatgaccgggctcgtccgcggc
gggctgctcgacctcgggcatttcgacgtgacggtcttcgcgctcgacgacgcgaacgac
gcggtcgtgcatgcggcggaacatggcgggccgttcaggatgacggtgatcgtgccgtag

DBGET integrated database retrieval system