KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4387Help
Entry
Bcenmc03_4387     CDS       T00669                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1359487..1360302)
Genome map
AA seq 271 aa AA seqDB search
MTGRTAVLLIHGLGGTQYDLGSLHKAMRRAGADTHMITLPGHGTRPEDLVGVRAEAWLDA
VTEQYRALEREYDTLHVAGMCMGALVALLLCHRVQHARGRLALLAAPVFIDGWSTPWYRS
LRHVLYRVPGVAERMRVEEGDPFGIKNATIRAIVKKKFERQDSFHYAWVPLACVRQVDRM
RDWVRDAAPGTPCPTLVLHAREDELTSLRSADFLLEKLPDARGIVLENSYHMICADNDRD
DVARHVLEFFGFDPVHAVSPAMARRMGRPAP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgggccgcacggccgtgctgctgatccacgggctcggcggcacgcaatacgatctc
ggttcgctgcacaaggcgatgcggcgcgcgggcgccgacacgcacatgatcacgctgccg
gggcacggcacgcgtccggaggatctggtcggcgtgcgcgcggaggcgtggctcgacgcg
gtgaccgagcagtaccgcgcgctggaacgcgagtacgacacgctgcacgtcgcggggatg
tgcatgggcgcgctcgtcgcgctgctgctgtgtcatcgcgtgcagcatgcgcgcggccgg
ctcgcgttgctggccgcgccggtattcatcgacggctggtcgacgccgtggtaccggtcg
ctgcggcacgtcctgtatcgcgtgccgggtgtggccgagcgaatgcgcgtggaggagggt
gatccgttcggcatcaagaacgcgacgatccgcgcgatcgtgaagaagaagttcgagcgg
caggacagtttccactatgcgtgggtgccgctcgcgtgcgtgcggcaggtggaccggatg
cgcgactgggtacgcgatgccgcgcccggcacgccgtgcccgacgctcgtgctgcatgcg
cgcgaggacgagctgacgagcctgcgctcggccgattttctgctggagaagctgcccgac
gcgcgcgggatcgtgctggagaacagctatcacatgatttgcgcggacaacgatcgtgac
gacgtcgcgcggcacgtgctcgaattcttcggcttcgatcccgtgcatgcggtgagcccg
gcgatggcgcggcggatggggcggccggcgccgtga

DBGET integrated database retrieval system