KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4480Help
Entry
Bcenmc03_4480     CDS       T00669                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00790  Folate biosynthesis
bcm01100  Metabolic pathways
Module
bcm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcenmc03_4480
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bcenmc03_4480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACA93620
JGI: Bcenmc034480
UniProt: B1K9M7
Position
2:1454624..1455259
Genome map
AA seq 211 aa AA seqDB search
MGKGKKTTQPQPVASRPSREQAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGY
ALEPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKL
ARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTS
RMLGTFRTDPSTRREFLSIVANPSSVNLTNT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggaaagaaaaccacacagccccagccggtcgcctcgcggccgagccgtgaa
caagccgaagacgccgtccgcgtgctgttgcgctgggccggcgacgatcccgcacgcgaa
ggcctgctcgacacgccggcacgcgtcgtgcgcgcatacgagcagttcttcgccggctat
gcgctggagccgcgcgacatcctcgcgcgcacgttcagcgaagtcgacggctacgacgaa
atgatcgtgctgaaggacatccgcttcgagagctactgcgagcaccatatggtgccgatc
atcggccgcgcgcacgtcgcgtatctgccgaatcatcgcgtcgtcggcatctcgaagctc
gcgcgcctcgtcgacgcgttcgcgaagcgcctgcagatccaggaaaagatgaccgtgcag
atcgccgacacgctgttcgacgtgctgcagccgaagggcgtcggcgtgatcctcgaagcc
gcgcaccagtgcatctccacgcgcggcgtgcacaagccgggcgtcgagatggtcacgtcg
cgcatgctcggcacgttccgcaccgatccgtcgacgcgtcgcgaattcctgtcgatcgtc
gcgaatccttcctcggtcaacctgacgaatacctga

DBGET integrated database retrieval system