KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4578Help
Entry
Bcenmc03_4578     CDS       T00669                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1567526..1569520)
Genome map
AA seq 664 aa AA seqDB search
MRLGVCYYPEHWPESMWADDARRMKALGIEQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LGAAGLEIVMCTPTATPPKWLIDRHPDILAIGADGRPRAFGSRRHYDFSSPVYLEASRQI
CTAVAERYGRHPAVRYWQTDNELGCHQTVVSYSPAALVRFREWLKARYGTIDALNRAWGT
VFWSMEYRHFDEVDAPVGTVTEAHPSHRLDYRRFASDELARYHRMQVDVIRAHSPGRPVA
HNFMQLFTEFDHYEVARDLDLATWDSYPLGALEELWFAPDVKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDEGGREAQRVAQEIAAVLDAGADADANGAVRAPVALVFDYDAKWLL
EVQPQGADFHYPRFAFEYYSALRSLGLDVDIVSAHAPLDGYRLVVVPPLPVVPDDFASRL
AASGAHAVFGPRTGSKTVDLQIPPALPPGPLASILPIRVWRVESLRPNVTERVDGTLRDG
SPLAGDARHWRDLVELNDDDTCSIVHARFADGHPACLSHGTLHYWAALFDEATTVRLFAD
IAAEAGLAPTPLGDAVRVSRRGGLTYVFNYASAPHTIDAVPPSAFVVGAAQVEPQGVAVY
RSRS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggagtctgctactacccggaacactggccggaatcgatgtgggccgacgac
gcccgccggatgaaagcgctcggcatcgagcaggtgcggatcgccgaattcgcgtggagc
cgcatcgagccgtcgccgggcgaatacgactggggctggctcgaccgtgcggtcgacgtg
ctcggcgcggctggcctcgagatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctgatcgaccgccaccccgacatcctcgcgatcggcgccgacggccggcctcgcgcgttc
ggttcgcgccgccactacgatttctcgtcgccggtctatctcgaagcgtcgcgccagatc
tgcacggcggtcgccgaacgctacggccgccacccggccgtgcgctactggcagaccgac
aacgaactcggctgccaccagaccgtcgtcagctattcgccggccgcgctcgtgcgcttt
cgcgaatggctgaaagcgcgctacggcacgatcgacgcgctgaaccgcgcgtggggcacc
gtgttctggagcatggagtatcgccatttcgacgaagtggacgcgcccgtgggcaccgtg
accgaagcccatccgtcgcatcgcctcgattaccggcgcttcgcgtccgacgagctcgcg
cgctatcaccggatgcaggtcgacgtgatccgcgcgcattcgccgggccgcccggtcgcg
cacaacttcatgcagctgttcaccgagttcgatcactacgaagtcgcgcgcgacctcgat
ctcgcgacgtgggacagctatccgctcggcgcgctcgaggagctgtggttcgcgcccgac
gtgaaggcgcgctggctgcgcaccggccatcccgatttcgcgtcgttcaatcacgacctg
taccgcggcatgtcgaagctgccgttctgggtgatggagcagcagccgggccccgtgaac
tgggcgcactggaaccccgcgccgctgccgggcatggtgcggctgtggagctgggaagcg
ttcgcgcacggcgccggctgcgtgtcgtatttccgctggcggcaggcgccgtttgcgcag
gagcagatgcacgcgggcctgaatacccccgataaccggctcgacgaaggcggccgcgaa
gcgcagcgcgtcgcgcaggaaatcgccgccgtgctcgacgccggcgccgatgccgacgcg
aacggcgcggtgcgcgcccccgttgcgctggtgttcgactacgacgcgaagtggctgctc
gaagtgcagccgcaaggcgccgatttccactacccgcgcttcgcgttcgagtactattcg
gcgctgcgttcgctcgggctcgacgtcgacatcgtttccgcgcacgcgccgctcgacggc
taccgcctcgtcgtcgtgccgccgctgccggtcgtgccggacgatttcgcgtcgcggctc
gccgcgtcgggcgcccatgcggtgttcggcccgcgcaccggctcgaaaaccgtcgacctg
cagattccgccggcattgccgcccggccccctcgcgtcgatcctgccgatacgcgtgtgg
cgcgtcgagtcgctgcggccgaacgtcaccgaacgagtcgacggcacgctgcgcgacggt
tcgccgctcgcgggcgacgcgcgtcactggcgcgacctcgtcgagctcaacgacgacgac
acgtgcagcatcgtgcacgcacgcttcgccgacggtcatccggcctgcctgtcgcacggc
acgctgcattactgggccgcgctgttcgacgaggcgaccaccgtgcgcctgttcgccgat
atcgcggccgaggcgggcctggccccgacgccgctcggcgatgccgtgcgcgtgagccgg
cgcggcggcctgacttacgtgttcaactatgccagcgcaccgcacacgattgacgcggtg
ccgccgtccgcgttcgtggttggcgccgcgcaggtcgagccgcaaggcgtggccgtgtat
cgaagccgttcgtag

DBGET integrated database retrieval system