KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4614Help
Entry
Bcenmc03_4614     CDS       T00669                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00051  Fructose and mannose metabolism
bcm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bcenmc03_4614
Enzymes [BR:bcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bcenmc03_4614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACA93752
JGI: Bcenmc034614
UniProt: B1K2U2
Position
2:1609122..1609904
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKEALVALAERRLENEVGDSGWSARQKLALTCRILFDAGHDSGLAGQITCRAD
AAGTYYTQRLGLGFDEISAANLLRVNEDLDVVDGEGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDACPLYDDCAFLKDWPGVPVGNEEGEIISKALGSKRAIL
LSHHGQLVVGKTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREAHDWISKPKRD
AVTFDYYVRRALRTHQDCVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgctgaatttgacgaaggaagcgctggtcgcgctggcggagcggcgtctg
gaaaacgaggtgggggacagcggctggtccgcgcggcaaaagcttgcgctgacctgccgg
attttgttcgacgccggccacgactcgggcctggccgggcagatcacctgccgtgcggac
gcggccggcacgtactacacgcagcggctcgggctcggcttcgacgagatctcggccgcg
aacctgctgcgcgtcaacgaggatctcgacgtcgtcgacggcgaaggcattccgaacccg
gccaaccggttccatacgtggatttatcgcgagcgcccggacgtgaactgcatcattcat
acgcatcccgcgcatgtcgcggcgctgtcgatgctcgaacagccgctcgtcgtgtcgcat
atggatgcctgcccgctgtacgacgactgtgcgttcctgaaggactggccgggcgtgccg
gtcggcaacgaggagggcgagatcatttcgaaggcgctcggcagcaagcgcgcgatcctg
ctgtcgcatcacgggcagctcgtggtcggcaagacgatcgaggaggcgtgcattctcgcg
ctgctgatcgaacgcgccgcgaagcttcagctgctcgcgatgtcggccggcgagatcaaa
ccggtgccgcccgcgctggcgcgcgaagcgcacgactggatctcgaagccgaagcgcgat
gcggtgacgttcgactactacgtgcgccgcgcattgcgtacgcatcaggactgcgtcgcg
taa

DBGET integrated database retrieval system