KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4865Help
Entry
Bcenmc03_4865     CDS       T00669                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase DUF1776 RmlD_sub_bind F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACA93995
JGI: Bcenmc034865
UniProt: B1K4N6
Position
2:1888793..1889668
Genome map
AA seq 291 aa AA seqDB search
MSKVWLVTGAARGLGRAISEAVLAAGDRLVAGARDPARLADLAERYGDRLLPVELDVTDE
AAAAQAVSAARAAFGRIDVLVNNAGYGHTAPFEQMSADAFRDQIETNLFGVINLTRAVLP
TMRAQRAGHIFQVSSVGGRTSTPGLSAYQAAKWAVGGFSDVLAKEAAPFGVRVCTLEPGG
MRTEWAAQAKRGVDDLLPDYQPSVGKILDLLGAYGGHEIGDPARIAALIVDLSRRDDVPL
RLLLGGDALFVCEQAERQRAEEAARWRDATLSTQFPDAKLPDGLDALKVIE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagtctggttggtaacgggggccgcacgcggcctcgggcgagcgatttcggaa
gcggtgctggcggcgggcgaccggctggtggcgggcgcccgcgatccggcgcgactggcc
gatctggccgaacggtatggcgaccggctgctgccggtcgaactcgacgtcaccgacgaa
gcggcggccgcgcaggccgtctcggcggcacgcgcggcgttcggccgcatcgacgtgctg
gtgaacaacgcgggctacggccacacggcgccgttcgagcagatgagcgccgacgctttc
cgcgaccagatcgaaacgaacctgttcggcgtgatcaacctcacgcgcgcggtgctgccg
acgatgcgcgcgcagcgcgcggggcacatcttccaggtgtcgtcggtcggcgggcgcacg
tcgacgcccggattgtccgcgtatcaggccgcgaagtgggcggtcggcgggttcagcgac
gtgctcgcgaaggaagccgcgccgttcggcgtgcgcgtgtgcacgctcgagccgggcggg
atgcgcaccgaatgggccgcgcaggcgaagcgcggcgtcgacgatctgctgcccgactat
caaccgtcggtcggcaagattctcgacctgctcggtgcgtatggcggccacgagatcggc
gaccccgcacgcatcgcggcgctgatcgtcgacctgtcgcgccgcgacgacgtgccgctg
cgtttgctgctcggcggcgatgcgctgttcgtctgcgagcaggcagagcggcagcgtgcg
gaagaggcggcgcggtggcgggacgccacgctgtcgacgcagtttccggatgcgaagctg
ccggacgggctcgatgcgttgaaggtgatcgagtaa

DBGET integrated database retrieval system