KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4895Help
Entry
Bcenmc03_4895     CDS       T00669                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcenmc03_4895
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Bcenmc03_4895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1921378..1921767
Genome map
AA seq 129 aa AA seqDB search
MTTDVLAVALRFFSLWTENRIDDALSMLSDDVLYDNVPFPDIVGRDNVRQFHGDFGIGTT
FKVDWTVTHIAAAGNVVLNERIDVFQHESGGKITLPVMGTLTIVDDRITVWRDYFDPADF
DRQLSAIKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgatgttttggccgtggcgcttcgattcttttcgctttggaccgaaaaccgc
atcgacgacgcgctgtcgatgctctccgatgatgtcctctacgacaacgttccgttcccc
gacatcgttggacgggacaatgttcgccaattccacggcgacttcgggatcggtacgacg
ttcaaggtcgactggacggtgacccatatcgccgcagcgggaaacgtcgtcctcaatgag
cggatcgacgtctttcaacacgaatcaggcggaaaaatcacgcttcccgtgatgggtacc
ctgaccatcgtcgatgatcgaatcacggtttggcgagactacttcgatcccgcggacttc
gatcggcagttgagtgcaatcaagaagtag

DBGET integrated database retrieval system