KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5151Help
Entry
Bcenmc03_5151     CDS       T00669                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00620  Pyruvate metabolism
bcm00640  Propanoate metabolism
bcm00680  Methane metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_5151
   00620 Pyruvate metabolism
    Bcenmc03_5151
   00640 Propanoate metabolism
    Bcenmc03_5151
  Energy metabolism
   00680 Methane metabolism
    Bcenmc03_5151
Enzymes [BR:bcm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcenmc03_5151
Lipid biosynthesis proteins [BR:bcm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcenmc03_5151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA94280
JGI: Bcenmc035151
UniProt: B1K6X6
Position
2:complement(2236530..2238524)
Genome map
AA seq 664 aa AA seqDB search
METRLSKIESVLHETRQFAPPAALEKTATISGMPAYRALVAEAEQDYEGFWARLAREGLT
WHKPFTKVLDERNAPFYTWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTRVTY
ADLLARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQACARIGATHSVVFGGFSAKS
LNERLVDVGAVALITADEQARGGKTLPLKSIADEAIALGGCEAVKSVIVYRRTGGKIDWH
AERDLWMHKLVDGESDRCEPTWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMK
WTFDWKPDDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHK
VTVFYTAPTAIRSLIKAAEADDKVHPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGHER
CPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGITAAVVDETGQDVPNGQGGILVV
KRPWPAMIRTIWGDPERFKKSYYPEELGGTLYLAGDGTVRDKETGYFTIMGRIDDVLNVS
GHRLGTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGDEAAALAKTLR
DWVGKQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQL
NRSM
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagacacgcttgtccaagatcgaatcggttcttcacgaaacccgtcagttcgcgccg
cccgcggcgctcgagaagacggcgaccatttccggcatgccggcctaccgcgcgctcgtc
gccgaggccgagcaggattacgaaggcttctgggcgcgtctcgcgcgcgaaggcctcacg
tggcacaagccgttcaccaaggtgctcgacgagcgcaacgcgccgttctacacatggttc
gacgacggcgagctgaatgcgtcgtacaactgcctcgaccgccacgtcgaagccggcaac
ggcgagcgcgtcgcggtgatcttcgaggccgacgacggcaccgtcacccgcgtcacctat
gccgatctcctcgcacgcgtgtcgcgcttcgccaatgcgctgaagaaacgcggcatcggc
aagggcgatcgcgtcgtcatctacattccgatgtcgatcgaaggcatcgtcgcgatgcag
gcctgcgcgcgcatcggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcg
ctgaacgagcggctcgtcgacgtcggcgcggtcgcgctgatcaccgccgacgaacaggcg
cgcggcggcaagacgctgccgctcaagagcatcgccgacgaggcgatcgcgctgggcggc
tgcgaagcggtcaagagcgtgatcgtctatcgccgcaccggcggcaagatcgactggcat
gcggagcgcgacctgtggatgcacaagttggtggacggcgaatccgaccgctgcgagccg
acctgggtcggcgccgagcatccgctgttcatcctgtatacgtcgggctcgaccggcaag
ccgaagggcgtgcagcacagcacgggcggctacctgctgtgggccgcgcagacgatgaag
tggaccttcgactggaaacccgacgacgtgttctggtgcacggccgacatcggctgggtc
acgggccatacatacatcacctacggcccgctcgcgtgcggcggcacgcaggtcgtgttc
gagggcgtgccgacgtatccggacgccggccgcttctggaagatgatcggcgatcacaag
gtcaccgtgttctacaccgcgccgaccgcgatccggtcgctaatcaaggccgccgaagcc
gacgacaaggtccatccgaagagctatgacctgtcgagcctgcgcatcatcggcacggtc
ggcgagccgatcaatccggaagcgtggatgtggtaccacaagcacgtcggccacgagcgc
tgcccgatcgtcgacacgtggtggcagaccgaaaccggcggccacatgatcacgccgctg
ccgggcgcgacgccgaccgtgccgggctcgtgcacgctgccgctgccgggcatcacggcc
gcggtggtcgacgagacggggcaggacgtgccgaacgggcaaggcggcattctggtcgtc
aagcgcccgtggcccgcgatgatccgcacgatctggggcgacccggagcgcttcaagaag
agctattacccggaagaactcggcggcacgctctatctggccggcgacggcaccgtgcgc
gacaaggagaccggctacttcacgatcatgggccggatcgacgacgtgctgaacgtgtcg
ggccaccggctgggcacgatggagatcgagtcggcgctggtgtcgcatgagctggtggcc
gaggcggcggtggtcggccgtccggacgacaccacaggcgaagcggtcgtcgcgttcgtg
gtgctgaagcgctcgcgcccggaaggcgacgaagcggcggcgctcgcgaagacgctgcgc
gactgggtcggcaagcagatcgggccgatcgcgaagccgaaggacatccgcttcggcgac
aacctgccgaagacccgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaag
ggcgaggcgatcacgcaggacacgtccacgctcgagaatccggccatcctcgaacagttg
aaccgctcgatgtaa

DBGET integrated database retrieval system