KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5348Help
Entry
Bcenmc03_5348     CDS       T00669                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00220  Arginine biosynthesis
bcm00250  Alanine, aspartate and glutamate metabolism
bcm00471  D-Glutamine and D-glutamate metabolism
bcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcenmc03_5348
   00220 Arginine biosynthesis
    Bcenmc03_5348
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bcenmc03_5348
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bcenmc03_5348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACA94475
JGI: Bcenmc035348
UniProt: B1K821
Position
2:complement(2464391..2465305)
Genome map
AA seq 304 aa AA seqDB search
MNYQSILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAYERFS
IQSISKLFACTLAFQLLGDELWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGSNDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PDTVIDAYCRQCAIEMNCVELATAALFLANGGIAPATGERVVDSSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYTE
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaatcgattcttgaacgcatccacaccgaactcgccccctggatcggccag
ggacgggtggccgactatattcccgagctcgcgaaagtgcccgccgacaagttcgggatg
gccgtcgtgacgctcgacggaaacgtttacacggtcggcgatgcgtacgagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgag
ctgtgggaacgggtcggccgcgagccgtccggcaccgcgttcaactcgctggtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaatgcgggcgcgctggtggtcacc
gacgtgctgtgccgccgcttcgtgaaggccgagacggcgctcgtcgaattcgtgcggcgg
ctgatcggctcgaacgacatcgactacgactcgcgcgtcgcgttgtcggagttgcagcac
gcggaacgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
cccgatacggtgatcgacgcgtattgccgccagtgtgcgatcgagatgaactgcgtcgag
cttgccaccgcggcgctgttcctcgcgaatggcggtatcgcgccggcgaccggcgaacgg
gtcgtcgattcgagttcggcgaagcggctgtcggcgctgatgttgacctgcgggacgtac
gatgcggcgggcgatttcgtgtatcgcgtcgggttgccggcgaaaagcggcgtcggcggc
gggatcgtcgcggtgctgcccggggagatggccgtgtgcgtgtgggcgccagggctggat
gcgaacgggaactcgctggcggggacattggcgctggagtggttgacgacttatacggag
cggtcgattttttga

DBGET integrated database retrieval system