KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5441Help
Entry
Bcenmc03_5441     CDS       T00669                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcenmc03_5441
Enzymes [BR:bcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Bcenmc03_5441
Peptidases [BR:bcm01002]
 Cysteine Peptidases
  Family C44
   Bcenmc03_5441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2566587..2568557
Genome map
AA seq 656 aa AA seqDB search
MCGIDGFLNSVAFDEETARGTLARMTASLAHRGPDGQGIWVDPDAGIALGHRRLAIVDLS
VHGRQPMASACGRYVLVFNGEIYNHRELRAELERAGRAPAWRGHSDSEVLIAAIVAWGVE
ATLRRATGMFAFALWNRASRVLTLARDRIGEKPLYYGRIGDALVFASELKALRGYPGFDG
TVDRDALCLYLRQSSVPAPYTIYRGIRKLPPGTYIQFEHARDTPRLRAYWTLEQAIEAGR
AQPFEGSAGEAVGQLDTVLRQAVARQMEADVPLGAFLSGGIDSSAIVALMQAQSATPVDT
FTIGFHEAGYDEAGYAKAVARHLGTRHTELYVTADHALGVVPKLPSIYDEPFSDASQIPT
FLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWRKLHRVPAAVRARIAAALHALRP
DHADQLAAVAQGAFGGGVEARESASRIGDRLHKLGHVMTAESRIGLYRLLMSSVHHPERL
ALSGQEPPTPLDTVSAWPAHLSFAEQAMAIDTLTYLPTDILAKVDRAAMAVSLETRMPFL
DHHVVEFAWRVPASVRLPEGQSKALLRRLLDRYVPSELIDRPKQGFCAPVDHWLRGALRD
WADALLRPSRLREEGFFDAAAVERLWRQHQTGRMNWQHQLWTVLMFQAWLEHQRAA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgacggctttctgaatagcgtcgccttcgatgaggagacagcgcgcggc
acgctcgcgcgaatgacggcgagcctcgcgcatcgcgggccggacgggcagggcatctgg
gtcgacccggatgccggcatcgcgctcggccaccggcggctcgcgatcgtcgacctgtcg
gtgcacggccggcagccgatggcttccgcgtgcggtcgctacgtcctcgtcttcaacggc
gaaatctacaaccatcgcgaactgcgcgcggagctcgagcgcgcagggcgtgcaccggcg
tggcgcggtcactccgacagcgaggtgctgatcgcggcgatcgtcgcgtggggcgtcgag
gccacgttgcgccgcgcgaccggcatgttcgcgttcgcgctgtggaatcgtgcgtcgcga
gtgctgacgctcgcgcgcgaccggatcggcgagaagccgctctactacgggcggatcggc
gacgcgctcgtgttcgcgtccgagctgaaggcgttgcgcggctacccgggcttcgacggc
acggtcgaccgcgacgcgctgtgcctgtacctgcgccagtcgagcgtgcccgcgccttat
acgatctatcgcggcatccgcaagctgccgcccggcacgtacatccagttcgaacatgcg
cgcgacacgccgcgcctgcgcgcgtactggacgctcgaacaggcgatcgaggccggccgc
gcgcagccgttcgagggcagcgccggcgaagccgtcggccagctcgacacggtcctgcgc
caggccgtcgcgcggcagatggaggccgacgtgccgctcggcgcgttcctgtcgggcggc
atcgattcgtcggcgatcgtcgcgctgatgcaggcgcaatcggcgacgccggtcgacacg
ttcacgatcggcttccacgaggccggctacgacgaagccggttacgcgaaggccgtcgcg
cgccatctcggcacgcgccataccgagctttacgtgacggccgaccatgcgctcggcgtc
gtgccgaagctgccgtcgatctacgacgagccgttctccgatgcgtcgcagatcccgacc
tttctcgtctcggaactgacgcgccggcacgtgaaggtgagcttgtccggcgacggcggc
gacgaattgttcggcggctatacgcgctacttcctgacgccacgcctgtggcgcaagctg
catcgcgtgccggcggcggtgcgtgcgcggatcgccgccgcgctgcacgcgttgcggccc
gatcacgcggaccagctcgcggccgtcgcgcagggtgcgttcggcggcggtgtggaagcg
cgcgaatccgcgtcgcgcatcggcgatcgcctgcacaagctcggccatgtgatgacggcc
gagagtcgcatcgggctgtaccggctgctgatgtcgtcggtgcatcatccggagcgcctc
gcgctgtcggggcaggagccgccgacgccgctcgacacggtgtccgcctggcccgcgcac
ctgagcttcgccgagcaggcgatggcgatcgacacgctcacgtacctgccgaccgacatt
ctcgcgaaggtcgatcgcgcggcgatggccgtgagcctcgagacgcgcatgccgttcctc
gatcatcacgtcgtcgaattcgcgtggcgcgtgccggcgtcggtgcgcttgccggaaggg
cagtcgaaggcgctgctgcgccggctgctcgaccggtacgtgccgtccgagctgatcgac
cggccgaagcagggtttttgcgcgcccgtcgaccactggctgcgcggcgcgctgcgcgac
tgggccgacgcgctgctgcggccgtcgcgcctgcgcgaagagggcttcttcgatgcggcg
gcggtcgagcggctgtggcgccagcaccagacgggccggatgaactggcagcaccagctg
tggacggtgctgatgttccaggcgtggctggaacatcagcgggcggcgtga

DBGET integrated database retrieval system