KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5628Help
Entry
Bcenmc03_5628     CDS       T00669                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2772981..2773949
Genome map
AA seq 322 aa AA seqDB search
MTELLHGDGAIRRTTPYGSSIENTYAGVLSFMRRNYSRALDGIDVAISGVPLDLATTYRS
GARLGPAAIRAASVQLAELHPYPWGFDPFDDLAAVDYGDCWFDAHNPLSIKPAIVEHART
ILRSGAKMLTLGGDHYITYPLLVAHAERYGKPLSLIHFDAHCDTWADDDPDSLNHGTMFY
KAVKEGLIDPATSVQVGIRTWNDDFLGIERLDAAWVHDHGARAAVERIVEIVGARPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRSLGAVNLVGADVVEVAPAYDHADITAIA
AAHVACDLLCLWRQKKVANALR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttctccacggcgacggcgcgatccgtcgcacgacgccgtacggttcctcg
atcgaaaacacctatgcgggcgtgctgtcgttcatgcgccgcaattactcgcgtgcgctc
gacggtatcgacgtcgcgatctccggcgtgccgctcgatctcgcgacgacctatcgttcc
ggcgcgcggctcgggccggccgcgatccgcgcggcgagcgtgcagctcgcggagctccat
ccgtatccgtggggcttcgatccgttcgacgatctcgcggccgtcgactacggcgactgc
tggttcgacgcgcacaatccgctgtcgatcaagccggcgatcgtcgagcatgcgcgcacg
atcctgcgctcgggcgcgaagatgctgacgctcggcggcgatcactacatcacgtatccg
ctgctggtcgcgcacgcggagcgctacggcaagccgctgtcgctgatccatttcgacgcg
cattgcgatacgtgggccgacgacgatccggacagcctcaatcatgggacgatgttctac
aaggccgtgaaggaagggctgatcgatcccgcgacgtcggtgcaggtcggcatccgcacg
tggaacgacgactttctcgggatcgagcggctcgatgccgcgtgggtgcatgaccatggc
gcgcgggcggcggtcgagcggatcgtcgagatcgtcggcgcgcggcctgcgtatctgacc
ttcgacatcgattgcctcgatccggcgttcgcgccgggaaccgggacgccggtggcgggc
ggcttgtcgtcagcgcaggcgctggcgatcgtgcgctcgctcggggcggtgaatctggtc
ggagcggatgtggtggaggtggcgcccgcgtacgatcatgcggacatcacggcgatcgcg
gccgcgcatgtcgcttgcgatctgctttgtttgtggcggcagaagaaggtggcgaacgcg
ttgcgttga

DBGET integrated database retrieval system