KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6009Help
Entry
Bcenmc03_6009     CDS       T00669                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Brite
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bcenmc03_6009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:3207087..3208508
Genome map
AA seq 473 aa AA seqDB search
MTARPAFPSPDASGTPAPRAPSRLLRRAAYVLGAAVIGYGAFAIAFPTQVPAAIGTVVAD
WTGANPHPVVLQRPAAQPLSAVAQLGRALFHDPSLSASGKQSCASCHSPDHAYGPPNALD
VQPGGLAMTQQGYRPPPSLMYLYRQPNFSIGPDAGENDAAPSVAQQATAAAGVVKAQKVA
GTSAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASIDDVTRKLAQSSHRAQFEQ
LFGARVFSTPQLAVSEAMFAIARYQVEDPSFHPYDSKYDRWLEGRARLTQAELRGLRLFN
DPDKANCAGCHLSKPGKDGLPPMFTDYQYEALGAPRNRALAQNRNPAFYDLGVCGPFRDD
LKDQTQYCGMFLTPTLRNAATRHVFFHNGVFHTLDQVMAFYNERSISPQKFYARGADGKV
DEYDDIPPKYRANVDVTDAPFDRKPGDKPAMTAQDIKDIEAFLGTLTDAPAQH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcgccccgcctttccgtcccccgatgcctccggcacgcccgcgccgcgcgcc
ccttcccgcctgctgcgccgtgccgcatacgtgctcggcgcggccgtgatcggctatggc
gcgttcgcgatcgcgtttcccacccaggtgccggcggcgatcggcaccgtggtcgccgac
tggaccggcgcgaatccgcatccggtcgtgctgcagcggcccgccgcgcagccgctgtcg
gcggtcgcgcagctcgggcgcgcgctgttccacgatccgtcgctgtccgcatcgggcaag
cagtcgtgcgcgtcgtgccatagtccggatcatgcgtatggcccaccgaatgcgctcgac
gtgcagccgggcggcctcgcgatgacacagcagggctatcgtccgccgccgtcgctgatg
tacctgtaccgccagccgaatttcagcatcggccccgacgccggtgaaaacgacgccgcg
ccgagcgtcgcgcagcaggccacggcggcggccggcgtcgtcaaggcgcagaaggtggcc
ggcacgtcggccgcgccgcagctcgtgccccagggcgggatgttctgggacggccgcgcc
gatacgttgcaacaacaggcgttcggcccgctgctgaatccggtcgaaatggcgaacgcg
agcatcgacgacgtgacgcgcaagctcgcgcagtcgtcgcatcgcgcgcagttcgagcag
ctgttcggtgcgcgcgtgttctccacgccgcagctcgcggtgtcggaggcgatgttcgcg
atcgcgcgctaccaggtcgaggatccgtcgttccatccgtacgacagcaagtacgaccgc
tggctcgaaggccgtgcgcgcctcacgcaggccgaactgcgcgggctgcgcctgttcaac
gatccggacaaggcgaattgcgcgggctgccacctgtcgaagcccggcaaggacggcttg
ccgccgatgtttaccgattaccagtacgaggcgctcggcgcgccgcgcaaccgcgcgctc
gcgcagaatcgcaacccggcgttctacgatctcggcgtgtgcgggccgttccgcgacgac
ctgaaggaccagacgcagtattgcgggatgtttctgacgccgacgctgcgcaatgcggcg
acgcgccacgtgttcttccacaacggcgtgttccacacgctcgatcaggtgatggcgttc
tacaacgagcgcagcatctcgccgcagaagttctatgcgcgcggcgcggacggcaaggtc
gacgaatacgacgacattccgccgaaatatcgcgcgaacgtcgacgtgaccgacgcgccg
ttcgatcgcaagccgggcgacaaacccgcgatgacggcgcaggacatcaaggatatcgaa
gcgtttctcggtacgctgacggacgccccggcgcaacactga

DBGET integrated database retrieval system