KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6083Help
Entry
Bcenmc03_6083     CDS       T00669                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcenmc03_6083
Enzymes [BR:bcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bcenmc03_6083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(64043..66232)
Genome map
AA seq 729 aa AA seqDB search
MTTDVPISALARAAGLQPDWTDAGGVARRVDDDALVALVDALGWPCGTAIQRVDSAAALA
DANASPPRLVTGDAGLPLTLPATLAPPGARFRISLETGGHVDGRVGGAGEHGTLPPLAMP
GYHALDISEQRIGLAIAPPRAQPFDGFARAHDAGRWGIAAQLYSLRRTGDDGAGDYTALA
RLAAQAARHGAQAVAISPTHAGYPALPAHDSPYSPSSRRWHNVAYLDCDAVPGADAAPRA
PAAVADAALIDWPSVLPAKLRRLRACFDAWRASDDPSRDTYQRFRAAGGAALDAHARFDA
LQAFCIEHGIGADWRQWPSQWRMSGSAEVDAFAHEHADTIAFHTFLQWCASRALGDAQHA
ARGAGMATGLIADLAVGSDQAGSDAWAHGTTLLRGVSLGAPPDLFNAAGQAWGVTTWTPD
ALRADGFMPFIELLRAAFAHAGGIRIDHVLGFARMWIVPDGGSPRSGAYLRYPLDDLVRL
VALEAARHRAIAIGEDLGTVPAGLRERLGAQGVAGMRVLWFERDADGAFRPPAAWDRDAI
AMTSTHDLPTVAGWWRGVDLGWRRVAAEVDAAKRRDEAQPPHDVAAPAPDDASAHDSDEI
VQRSDSNHSTPPPPPELLAAHAERAAERAALWRALQAAGCAPAGAAVPPTDMPPVNAILA
YVASSPSPLALLPLEDLLALDAQPNLPGPPCGHPNWRQRLPRTIDALFDADVRTRIAAVV
DARSRRHGP
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtcccgatctcggcactcgcccgtgcggccggcctgcaacccgactgg
accgacgcgggcggcgtcgcgcggcgcgtggacgacgacgcgctggtcgcgctcgtcgat
gcgctcggctggccgtgcggcaccgcgatccagcgggtcgacagcgcggcggcgctcgcc
gatgcgaacgcgtcgccgccacgcctcgtgaccggcgacgccggcttgccgctgacgctg
cccgcgaccctcgcgccgccgggcgcgcgcttcaggatctcgctcgaaaccggcgggcat
gtggacggacgcgtgggcggcgcgggtgaacacggcacgctgccgccgctcgcgatgccc
ggctatcacgcgctcgacatcagcgagcagcgcatcgggctcgcgatcgcgccgccgcgg
gcgcagccgttcgacgggttcgcccgcgcgcacgacgcgggccgctggggcatcgcggcg
cagctctacagcctgcgccgcaccggcgacgacggcgcgggcgactacacggcgctcgcg
cggctcgccgcgcaggcggcgcgccacggcgcgcaggcggtggcgatcagcccgacgcat
gccggctatccggcgcttcccgcgcacgacagcccgtattcgccgtcgtcgcggcgctgg
cacaacgtcgcgtatctcgactgcgacgcggtgccgggcgccgacgccgcgcctcgcgca
ccggccgccgtggccgacgccgcgctgatcgactggcccagcgtgctgccagcgaagctg
cgccgcttgcgtgcgtgcttcgacgcatggcgcgcgagcgacgacccgtcgcgcgacacg
taccagcggtttcgcgcggcgggcggcgcggcgctcgacgcgcacgcgcgcttcgatgcg
ctgcaggcgttctgcatcgagcacgggatcggtgcggactggcggcagtggccgtcgcaa
tggcgcatgtcggggtcggcggaagtcgacgcgttcgcgcatgagcatgccgacacgatc
gcgttccacaccttcctgcaatggtgcgcgtcgcgcgcgctcggcgacgcgcagcacgcg
gcgcgcggcgcgggcatggccaccgggctgatcgccgatctcgcggtcggctccgatcag
gccggcagcgacgcgtgggcgcacggcacgacgctgctgcgcggcgtatcgctcggcgcg
ccgcccgacctgttcaatgcggccggccaggcgtggggcgtgacgacctggacgcccgac
gcgctgcgcgcggacggcttcatgccgttcatcgagctgctgcgcgccgcgttcgcgcac
gccggcggcatccgcatcgaccacgtgctcggcttcgcgcggatgtggatcgtgccggac
ggcggctcgccgcgcagcggcgcgtacctgcgctatccgctcgacgatctggtgcggctc
gtcgcgctcgaggcggcgcgccatcgcgcgatcgcgatcggcgaggatctgggcaccgtg
ccggccggcttgcgcgaacggctcggcgcgcagggtgtcgcggggatgcgcgtgctgtgg
ttcgagcgcgatgcggatggcgcgttccggccgcccgccgcgtgggatcgcgacgcgatc
gcgatgacctcgacgcacgatttgccgaccgtggccggctggtggcgcggcgtcgatctc
ggatggcggcgcgtcgcggccgaggtcgacgccgcgaagcggcgcgacgaagcgcaacca
ccgcacgacgtcgccgcaccggcgccggacgatgcgagcgcccacgattcggacgagatc
gtgcagcgctccgattcgaatcactcgacgcccccgccgcctcccgagctgctcgccgct
catgcggaacgcgccgccgagcgcgccgcgctgtggcgcgcgctgcaagcagccgggtgc
gcgccggcaggcgccgcggtgcctccaaccgacatgccgccggtgaatgcgatcctggcc
tatgtcgcaagcagcccgtcgccgctcgcgctgctgccgctcgaggatctgctggccctc
gatgcgcagccgaacctgccggggccgccgtgcggccatccgaactggcggcagcggttg
ccgcgcacgatcgacgcgctgttcgacgccgacgtgcgcacgcgcatcgcggccgtcgtg
gatgcgcgctcgcggaggcatggcccatga

DBGET integrated database retrieval system