KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6086Help
Entry
Bcenmc03_6086     CDS       T00669                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcenmc03_6086
Enzymes [BR:bcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bcenmc03_6086
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcenmc03_6086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(70259..72469)
Genome map
AA seq 736 aa AA seqDB search
MTDTLFDRADIDALLAGRHPDPFACLGPHEQDDQIVVRALLPGAERVRALSPDGAELGTL
ACVDRAGCFAGTIAHDGGAPHYLLSIDWPDAHQVTDDAYAFGTLLDEAALARFSAGDPEA
VLDCLGATPVRIDDTDGVRFAVWAPNAQRVSVVGDFNAWDGRRHPMRLRRPSGVWELFVP
GIGAGERYKFELCAADGRVLPHKADPCARATEAPPRTASVVADVAALHAFAWHDDGWMRA
RPRHDDRYRVPWSIYEVHPESWQRIPEQMDRSATWDELAERLIPYVKGMGFTHVEFMPIA
EYPFGGSWGYQPLAQFAPSARFGPVDGFARFVDRAHAAGIGVLVDWVPAHFPNDAHGLAQ
FDGSALYEHADPREGMHPDWNTCVFNVGRNEVSAFLVASALAWARRYHVDGIRVDAVASM
LYRDYSRKEGEWVPNVYGGRENLESVAFLRRLNDTLHGDVAPAGVVTVAEESTAWPGVTA
PTADGGLGFDFKWNMGWMHDTLAYLHEDPIHRRYHHDRMTFGLVYAFSERFVLPLSHDEV
VHGKGSLVAKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWSEFAHDATPHWDL
LDAPAHRGVQRLVRDLNRAYAAEPALHALDCHAAGFSWLIGDDRDNSVFAFARRDDTGRL
VVAVCNFTPVPRAGYRLGLPAPGHWRELMNTDAASYGGTNAGNDGAVWAEAVPAHGEAWS
ASLRLPPLATLWLTPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgctgttcgaccgcgccgatatcgatgcgctgctcgccggccgccatccc
gacccgttcgcgtgcctcggcccgcacgaacaggacgaccagatcgtcgtgcgcgcgctg
ctgcccggcgccgagcgcgtgcgcgcgctgtcgccggacggcgccgaactcggcacgctc
gcctgcgtcgatcgcgccggctgcttcgcgggaacgatcgcgcacgatggcggcgcgccg
cactatctgctctcgatcgactggccggatgcgcatcaggtgaccgacgatgcgtacgcg
ttcggcacgctgctcgacgaagcagcgcttgcgcgtttttcggccggcgaccccgaagcc
gtgctcgactgcctcggcgcgacaccggtgcgcatcgacgacaccgacggcgtgcgtttc
gcggtgtgggcgccgaatgcgcagcgcgtatcggtggtcggcgatttcaacgcatgggac
ggccgccgccatccgatgcggctgcggcggccgtcgggcgtgtgggagctgttcgtgccg
ggtatcggcgcgggcgagcgctacaaattcgagctgtgcgcggccgacgggcgtgtgctg
ccgcacaaggccgatccgtgcgcgcgggcgaccgaggcgccgccgcgcacggcgtcggtg
gtcgccgacgtcgctgcgctccacgcgttcgcctggcacgacgacggctggatgcgcgcg
cggccgcgccacgacgaccgctatcgcgtgccgtggtcgatctacgaggtccatccggag
tcgtggcagcgcatccccgaacagatggaccgcagcgcgacgtgggacgaactcgccgag
cggctgattccgtacgtgaaggggatgggcttcacgcacgtcgaattcatgccgatcgcc
gaatacccgttcggcggctcgtggggctaccagccgctcgcgcagttcgcgccgtccgcg
cgcttcgggccggtcgacggcttcgcgcgcttcgtcgatcgcgcgcacgcggccggtatc
ggcgtgctcgtcgactgggtgcccgcgcattttccgaacgacgcgcacgggctcgcgcaa
ttcgacggcagcgcgctgtacgagcatgccgatccccgcgaggggatgcaccccgactgg
aacacctgcgtgttcaacgtcgggcgcaacgaggtcagtgcgttcctcgtcgcgtcggcg
ctcgcgtgggcgcgccgctatcacgtcgacggcatccgcgtcgacgcggtcgcgtcgatg
ctgtatcgcgactattcgcgcaaggaaggcgaatgggtgccgaacgtgtacggcggccgc
gaaaacctcgaatcggtcgcgttcctgcgccggctgaacgacacgctgcacggtgacgtc
gcgccggccggcgtcgtcaccgtcgcggaggaatcgaccgcgtggccgggcgtcaccgcg
ccgaccgccgacggcgggctcggcttcgacttcaagtggaacatgggctggatgcacgac
acgctcgcgtacctgcacgaagacccgatccaccgccgctatcaccacgaccggatgacg
ttcgggctcgtgtacgcgttctccgagcgcttcgtgctgccgctgtcgcacgacgaggtc
gtgcacggcaagggctcgctcgtcgcgaagatgcccggcgacgcgtggcagcggctcgcg
acgctgcgcgcgtatttcggcttcatgtgggcacaccccggcaagaagctgctgttcatg
ggcagcgaattcgcgcagtggagcgagttcgcgcacgacgcgacgccgcactgggatttg
ctcgacgcgcccgcgcatcgcggcgtgcagcggctcgtgcgcgacctcaaccgcgcgtat
gcggccgagccggcgctgcatgcgctcgactgccacgcggccggcttctcctggctgatc
ggcgacgaccgcgacaacagcgtgttcgcgttcgcgcgccgcgacgatacggggcgcctg
gtcgtcgccgtctgcaacttcacgcccgtgccgcgcgccggttaccggctcggcctgccc
gcgcccggccactggcgcgaactgatgaacaccgatgccgcgtcgtacggcggcaccaac
gccggcaacgacggcgccgtgtgggccgaagccgtgcccgcgcacggcgaggcgtggtcg
gcgagcctgcgcctgccgccgctcgcgacgctctggttgacccctgcctga

DBGET integrated database retrieval system