KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6331Help
Entry
Bcenmc03_6331     CDS       T00669                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_6331
   00052 Galactose metabolism
    Bcenmc03_6331
Enzymes [BR:bcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bcenmc03_6331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:344878..345966
Genome map
AA seq 362 aa AA seqDB search
MHIDTDSSYLTPGAARVLSEPWGTLPDGEPVRRYTLRNVHGMRVVVSDLGATVVSWLAPD
RTGRLADIVLAHDTPAEYLESGAYLGATVGRWANRIAGAHFTLDGVDYLLDRNENGNLLH
GGANGFHRARWDVLDDGGGLTLQLDSPEGDAGFPGNVRVQVRYTLDDDGTLTIDYSGWTD
APTPLNLTNHSYFNLNGRAGSDVRGHLLHIDADAFLEVDDALIPTGTADVTGTAFDFRQS
APLGARLDWPHAQLARARGFDHCYVVDNGAREVRPVARIYDPESGRELIVSTDQRGLQLY
TGNYLDGLRVSGGTRCVPHAALCVEAGGFPDQVNMDGLRDDVIVRPGDVYRQTTRYRVAV
QA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcgataccgattcctcatacctgacgcccggcgcggcacgcgtgctttccgag
ccgtggggcacgttgcccgacggcgagcccgtgcgacgctatacgctgcgcaacgtgcac
ggaatgcgcgtcgtcgtcagcgacctcggcgcgaccgtcgtgtcgtggctcgcgcccgat
cgcaccgggcgcctggccgatatcgtgctcgcgcacgacacgccggccgagtacctcgaa
tccggcgcctatctcggcgcgacggtcggccgctgggcgaaccggatcgccggcgcgcac
ttcacgctcgacggcgtcgactacctgctcgaccgcaacgagaacggcaacctgctgcac
ggcggcgcgaacggttttcatcgcgcgcggtgggacgtgctcgacgatggcggcgggctg
acgctgcaactcgattcgccggaaggcgacgcgggattccccggcaacgtgcgcgtgcag
gtgcgctacacgctcgacgacgacggcacgctgacgatcgactattcggggtggaccgat
gcgccgacgccgctgaacctgacgaatcacagttacttcaacctgaacgggcgcgcgggc
agcgacgtgcgcggccatctgctgcacatcgacgccgatgcattcctcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcacggccttcgatttccggcaaagc
gcgccgctcggcgcgcgcctcgactggccgcatgcgcaactggcgcgggcgcgcggcttc
gatcactgctacgtcgtcgacaacggcgcgcgcgaggtccggcccgtcgcacgaatctac
gatccggaaagcggccgcgagctgatcgtgtcgaccgatcagcgcgggctgcaactctat
acgggcaactatctcgacggcctgcgcgtgagcggcggcacgcgctgcgtgccacacgcg
gcgctgtgcgtcgaggcgggaggctttccggatcaggtcaacatggacggcctgcgcgac
gacgtgatcgttcgtccaggcgacgtgtaccgacagaccacgcggtatcgggtcgccgtt
caggcatag

DBGET integrated database retrieval system