KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6708Help
Entry
Bcenmc03_6708     CDS       T00669                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00071  Fatty acid degradation
bcm00072  Synthesis and degradation of ketone bodies
bcm00280  Valine, leucine and isoleucine degradation
bcm00310  Lysine degradation
bcm00362  Benzoate degradation
bcm00380  Tryptophan metabolism
bcm00620  Pyruvate metabolism
bcm00630  Glyoxylate and dicarboxylate metabolism
bcm00640  Propanoate metabolism
bcm00650  Butanoate metabolism
bcm00900  Terpenoid backbone biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01212  Fatty acid metabolism
bcm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcenmc03_6708
   00630 Glyoxylate and dicarboxylate metabolism
    Bcenmc03_6708
   00640 Propanoate metabolism
    Bcenmc03_6708
   00650 Butanoate metabolism
    Bcenmc03_6708
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_6708
   00072 Synthesis and degradation of ketone bodies
    Bcenmc03_6708
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcenmc03_6708
   00310 Lysine degradation
    Bcenmc03_6708
   00380 Tryptophan metabolism
    Bcenmc03_6708
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcenmc03_6708
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcenmc03_6708
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcenmc03_6708
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcenmc03_6708
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcenmc03_6708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACA95822
JGI: Bcenmc036708
UniProt: B1KC75
Position
3:793208..794398
Genome map
AA seq 396 aa AA seqDB search
MTTQDPIVIVGAARTPMGGFQGDLAAASASDLGAVAIRAALERANVPAERIEEIVFGCVL
PAGQGQAPARQAALKAGLPLGAGATTVNKMCGSGMKAAMFAHDLLLAGSAAAAVAGGMES
MTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGTFAEDCAQAYQFTREAQD
AFAIASLTRAQRAIAEGRFVAEIAPVTVKAGKTESVVSIDEQPGKAKLDKIPTLKPAFRD
GGTVTAANASSISDGAAALVMMRRSEAERLGLTPKAVIVGHATHADKPGLFATAPIGALR
KLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHEKVNVHGGACALGHPIGASGARV
MVTLLAALETYGLTRGVASLCIGGGEATAIAIERIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaggatccgatcgtaatcgtgggcgcggcgcgcacgccgatgggtggtttt
cagggtgacctggcggcggcgagcgcgagcgaccttggcgcggtggcgattcgcgccgcg
ctcgagcgcgcgaacgtgccggccgaacgcatcgaggaaatcgtgttcggctgcgtgctg
ccggccggtcagggccaggcgcccgcgcgacaggccgcgctgaaggccgggctgccgctc
ggggcgggcgcgaccacggtcaacaagatgtgcggctcggggatgaaggcggcgatgttc
gcgcacgacctgctgctggccggttcggcggcggcggccgtggcgggcgggatggagagc
atgacgaatgcgccgtacctgctgccgaaggcgcgcgcgggcatgcgcatgggtcacgga
caggtgctcgatcacatgttcctcgacgggctcgaggacgcatatgaaaagggccgcctg
atgggcacgttcgccgaggattgcgcgcaggcgtaccagttcacccgcgaagcgcaggat
gcgttcgcgattgcgtcgctgacgcgggcgcagcgcgcgatcgcggaagggcggttcgtg
gcggaaatcgcgccggtgaccgtgaaggccggcaagacggaaagcgtcgtgtcgatcgac
gagcagcccggcaaggcgaaactcgacaagatcccgacgctgaagccggcgtttcgcgac
ggcggcacggtgacggccgcgaacgcatcgtcgatctcggacggcgcggccgcgctcgtg
atgatgcgccgctcggaagccgagcgcctcggcctcacgccgaaggccgtgatcgtcggg
catgcgactcatgcggacaagcccggcctgttcgcgaccgcgccgatcggcgcgttgcgc
aagctgtcggagaaaaccggctggaacctgcgggacgttgacctgttcgagatcaacgaa
gcgttcgcggtggtgccgatggccgcgatgcgcgacctcgacctgccgcacgagaaggtg
aacgtgcacggcggcgcgtgcgcgctcgggcatccgatcggcgcatcgggtgcgcgcgtg
atggtgacgctgctggccgcgctcgaaacgtatggcctgacgcgcggcgtcgcatcgctg
tgcatcggcggtggtgaagcgacggccatcgcgatcgagcgcatcgcgtaa

DBGET integrated database retrieval system