KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6834Help
Entry
Bcenmc03_6834     CDS       T00669                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bcenmc03_6834
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcenmc03_6834
   00650 Butanoate metabolism
    Bcenmc03_6834
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_6834
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcenmc03_6834
   00310 Lysine degradation
    Bcenmc03_6834
   00360 Phenylalanine metabolism
    Bcenmc03_6834
   00380 Tryptophan metabolism
    Bcenmc03_6834
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcenmc03_6834
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcenmc03_6834
   00281 Geraniol degradation
    Bcenmc03_6834
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcenmc03_6834
   00627 Aminobenzoate degradation
    Bcenmc03_6834
   00930 Caprolactam degradation
    Bcenmc03_6834
Enzymes [BR:bcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcenmc03_6834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:932967..933704
Genome map
AA seq 245 aa AA seqDB search
MDAKRADLLDLTQEGVVLTLTLNRPDARNALNLALTEALVDAIHRFEADESLRVLIVTGA
DPAFCAGLDLNDFSAPDAPRARVAEMIDMWARISKPVIAAVNGAAVTGGLELAMGCDFII
ASERARFADTHTKIGALAGGGMTARLPHIVGSRWAKQFSFTSEPIDAATALRIGLVNEVL
AHDQLMERAAAVANTIASRDPDLVATVKRVIDQGALATLEEALRIEKEALAERRQRGGMA
WQVQK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaagcgagccgatttgctggacctgacgcaagagggcgtggttctcacgctg
acactgaatcggcccgacgcccgcaacgcgttgaaccttgcgttgactgaagcgctcgtc
gacgcaatccaccggttcgaagccgacgaaagcctgcgtgtgctcatcgtcacgggcgcc
gatccggccttttgcgcgggactcgatctgaatgacttctccgcccccgatgcgccgcgt
gcgcgagtcgcggaaatgatcgatatgtgggcgcgcattagcaagcccgtcatcgcggct
gtgaacggcgccgccgtcaccggcgggctcgagcttgcgatggggtgcgatttcatcatc
gcgtcggagcgcgcacgctttgccgacacgcacacgaaaattggcgcacttgccggtggt
ggaatgactgcgcggttgccgcatatcgtgggctcaaggtgggccaagcagttcagcttc
acgagcgagccgatcgacgcggccacggcattgcgcatcggcctcgtcaacgaggtgctt
gcgcacgatcagttgatggagcgtgccgcggcggtagcgaatacgattgcgagccgcgat
cccgatctcgtcgcaacagtcaagcgcgtgatcgatcagggtgcactggcaacgctcgaa
gaagcattgcgtatcgagaaagaggctttggcggaacgaaggcaacgcggcggcatggcg
tggcaggtgcagaagtag

DBGET integrated database retrieval system