KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6877Help
Entry
Bcenmc03_6877     CDS       T00669                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00020  Citrate cycle (TCA cycle)
bcm00620  Pyruvate metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Module
bcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_6877
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_6877
   00620 Pyruvate metabolism
    Bcenmc03_6877
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcenmc03_6877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: ACA95980
JGI: Bcenmc036877
UniProt: B1KCN3
Position
3:978678..979490
Genome map
AA seq 270 aa AA seqDB search
MSIESANRPQANANAGPVETAAPAFGANLPPWPQVDFAEFGEVEVKPVSRIQKLTGAFLS
RNWLTIPHVTHHDDVDITSVETWRSARNDANPAVKLTPLVLLIKAVVRALQAFPQFNASL
DGDGKNIVLKKYFHIGVAVDTRHGLLVPVLRDCDKKSVEELAVELAAISQKAREKGLSMA
EMSGGCFSISSLGGFGGTGFTPIVNAPEVAILGVTKARLAAAPAEDGGISWRKMLPLSLS
YDHRVINGADAARFTAFIGTVLADPQTLAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaatccgccaaccggccgcaggccaatgcgaatgccgggccagtcgaaacc
gcggcgcccgcgttcggtgcgaacctgccgccctggccgcaggtcgacttcgccgaattc
ggtgaggtcgaggtcaagccggtttcccgtatccagaagctcactggggctttcctgtcg
cgcaactggctgacgattccgcatgtgacgcaccacgacgacgtggatatcacgtcggtt
gaaacctggcgcagcgcgcgcaacgacgcgaacccggccgtgaagctcacaccgctcgtc
cttctgatcaaggccgtggttcgagcgttgcaggcttttcctcaattcaatgcatcgctc
gatggggacggcaagaacatcgttctcaagaagtatttccacatcggggtcgcggtcgat
acccgccatgggctgctcgtgcccgtgctgcgcgattgcgacaagaaaagcgtcgaggaa
ctcgcggtcgagctcgcggcgatttctcaaaaggcacgcgaaaaaggcctttcgatggcc
gaaatgtcaggcggctgcttttcgatcagctcgctcggcggcttcgggggtaccggcttc
acgcctatcgtcaatgcgcccgaggtagcgattctcggcgtgaccaaagcgcggttggcg
gcggcgccggcagaggacggcgggatcagctggcgcaagatgcttccgctctcgctgagc
tacgatcatcgcgtcatcaacggagccgatgcggcacgcttcaccgctttcatcgggacc
gtgctggccgatccgcagacgctcgcaggctga

DBGET integrated database retrieval system