KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6973Help
Entry
Bcenmc03_6973     CDS       T00669                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_6973
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bcenmc03_6973
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcenmc03_6973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1084425..1085465
Genome map
AA seq 346 aa AA seqDB search
MNDYDRDAYAVLLPAFAGLTLSDDVCRYLDRGGVSVLLGETRDEYVGRAMSAQRRTEETA
AHFRDVVESTRRRAGSGVLVAVDQELGGIQRLHALVPALPSLDDALRAGTETIVERSAAV
AAAARELGVNLFLSPIADVVVGANPWLDGRHLGADAADVLRIARAFVQGVQSAGVAATAK
HFPGHPVTALDPALDESVVGGGLAELAPTLDVFRALIAGGVKAVMAGPALVPAIDVEHPS
STSRDTLSMLRHEFSFHGLIISDDLDAPGILRGRSIEATAVAALDAGADLLLVSSEAGLD
RIAGTIVEAVRSGALDASRLAQAAHRVRALARELDGVQVAGRNERA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgattacgatcgagacgcttacgcggttctgttgccggcattcgcgggcctgacg
ctcagcgacgatgtgtgccgatatctcgaccggggcggcgtgtcggtactgctgggcgag
acgcgtgacgagtacgtcggacgcgcgatgagcgcgcagcgccgcacggaagagaccgcc
gcgcacttcagggatgtcgtcgaatcgacccggaggcgggcagggtcgggagtgctggtg
gccgtcgatcaggaactcggcgggatacaacgcctgcatgcgctcgtgcccgcgctgccg
tcgctcgacgacgccttgcgcgccggcaccgagacgatcgttgaaagatccgccgcggtc
gccgcggcggcgcgcgaactgggcgtcaacctgtttctgtcgccgatcgccgatgtcgtg
gtgggcgcgaatccctggctcgacgggcggcatctcggcgccgatgccgccgatgtactg
cgcattgcccgcgcgttcgtgcagggcgtgcaatcggcgggcgtcgcggcaaccgccaag
catttccccgggcatccggtcacggcgctcgatccggcgctcgacgagtcggtcgtgggc
ggcgggctcgccgagttggcgccgacgctcgacgtgtttcgggcattgatcgccggcggc
gtcaaggcggtcatggcggggcccgcgctggtgcctgccatcgatgtcgagcatccatcg
agcacgtcgcgcgatacgctttcgatgctgcggcacgaattctcgttccacgggctcatc
atttccgacgatctggatgcgcccggcatcttgcgcggcagaagcatcgaagccacggcc
gtcgccgcgctggatgccggtgccgatctgctgctcgtgtcgagcgaagccgggctcgac
cgcattgcgggcacgatcgtcgaagccgtcaggagcggcgcgctcgacgcgtcgcggctg
gcgcaggcggcccaccgcgtgcgcgcgctcgcacgggaactggatggcgtgcaggtcgcc
ggccgcaacgagcgcgcgtga

DBGET integrated database retrieval system