KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6973Help
Entry
Bcenmc03_6973     CDS       T00669                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00520  Amino sugar and nucleotide sugar metabolism
bcm01100  Metabolic pathways
bcm01501  beta-Lactam resistance
Module
bcm_M00628  beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_6973
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bcenmc03_6973
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcenmc03_6973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 CBP
Motif
Other DBs
NCBI-ProteinID: ACA96074
JGI: Bcenmc036973
UniProt: B1K9X4
Position
3:1084425..1085465
Genome map
AA seq 346 aa AA seqDB search
MNDYDRDAYAVLLPAFAGLTLSDDVCRYLDRGGVSVLLGETRDEYVGRAMSAQRRTEETA
AHFRDVVESTRRRAGSGVLVAVDQELGGIQRLHALVPALPSLDDALRAGTETIVERSAAV
AAAARELGVNLFLSPIADVVVGANPWLDGRHLGADAADVLRIARAFVQGVQSAGVAATAK
HFPGHPVTALDPALDESVVGGGLAELAPTLDVFRALIAGGVKAVMAGPALVPAIDVEHPS
STSRDTLSMLRHEFSFHGLIISDDLDAPGILRGRSIEATAVAALDAGADLLLVSSEAGLD
RIAGTIVEAVRSGALDASRLAQAAHRVRALARELDGVQVAGRNERA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgattacgatcgagacgcttacgcggttctgttgccggcattcgcgggcctgacg
ctcagcgacgatgtgtgccgatatctcgaccggggcggcgtgtcggtactgctgggcgag
acgcgtgacgagtacgtcggacgcgcgatgagcgcgcagcgccgcacggaagagaccgcc
gcgcacttcagggatgtcgtcgaatcgacccggaggcgggcagggtcgggagtgctggtg
gccgtcgatcaggaactcggcgggatacaacgcctgcatgcgctcgtgcccgcgctgccg
tcgctcgacgacgccttgcgcgccggcaccgagacgatcgttgaaagatccgccgcggtc
gccgcggcggcgcgcgaactgggcgtcaacctgtttctgtcgccgatcgccgatgtcgtg
gtgggcgcgaatccctggctcgacgggcggcatctcggcgccgatgccgccgatgtactg
cgcattgcccgcgcgttcgtgcagggcgtgcaatcggcgggcgtcgcggcaaccgccaag
catttccccgggcatccggtcacggcgctcgatccggcgctcgacgagtcggtcgtgggc
ggcgggctcgccgagttggcgccgacgctcgacgtgtttcgggcattgatcgccggcggc
gtcaaggcggtcatggcggggcccgcgctggtgcctgccatcgatgtcgagcatccatcg
agcacgtcgcgcgatacgctttcgatgctgcggcacgaattctcgttccacgggctcatc
atttccgacgatctggatgcgcccggcatcttgcgcggcagaagcatcgaagccacggcc
gtcgccgcgctggatgccggtgccgatctgctgctcgtgtcgagcgaagccgggctcgac
cgcattgcgggcacgatcgtcgaagccgtcaggagcggcgcgctcgacgcgtcgcggctg
gcgcaggcggcccaccgcgtgcgcgcgctcgcacgggaactggatggcgtgcaggtcgcc
ggccgcaacgagcgcgcgtga

DBGET integrated database retrieval system