KEGG   Burkholderia cenocepacia AU1054: Bcen_0043Help
Entry
Bcen_0043         CDS       T00363                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Bcen_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:41293..44319
Genome map
AA seq 1008 aa AA seqDB search
MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTAAAQGSLGFAVSEQGV
GNRLSLTDDALARNLADVQLRGGLPPSGLPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLAITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASAAI
QIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARVELDVATAAGVKRQIVSATDGDDLERLTKRALYAGLRIGEVHAVKGAEY
VELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRRYDENGMPVKGDYALIFEEEYARAARVPAYRALFDGVDVALEVERAHNGYFSIDR
KGGWTDTSESSAAARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDAGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEEHQFAALPVQEDGGPAHALGIELSRVLWNHLHEQGYVDAQGKVLDRLKDA
LRRSALVLPDAFEPLRAPIVATLRKLSGRFAVRNADERRAIALRRDASGKAVVFGEDFRA
LWDRIRHRTVYRVEFDNAKLVRDCTAALRDAPDIARARLQWRKAEIDIGKAGIEAIEVAG
AGTVLLDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLDDFRVNPQQFIAVAADAIN
RCKRLALVAGIAYRKLGERHVHALESFESEALTGYLRNLRPDARKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVQTPLGSYHPDWAVLAEQDGGERLYFVVDTPNADGHVP
SEHERAKLACGEAHFRALVDGDGAARFVRVTQADALFEPAAPTAGAGR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcatttcgaagcggatctcgactaccagcgcgaggcgatcgacgccgtctgc
gacctgtttcgcgggcaggaatcgtatcgcggcgacttcagcgtgctcgcgaacgccgcg
cccggcacgacggccgccgcgcaaggctcgctcggcttcgcggtatcggagcaaggcgtc
ggcaaccggctgtcgctgaccgacgacgcgctcgcgcgcaatctcgccgacgtgcagttg
cgcggcgggctgccgccgtccggcctgcccggctcgcgcgacttcaccgtcgagatggag
accggcaccggcaagacctacgtgtacctgcgcacgatcttcgagctgaaccgccgctac
ggcttcacgaaattcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctcgcgatcaccgaggatcacttccgcgcgctgtacgcgggcgtgccgtacgactac
ttcctgtacgactccgcgaagctcggccaggtgcgtcacttcgcggcgagcgcggcaatc
cagatcatggtgatgacggtcgccgcgatcaacaagaaagagatcaacaacctctacaag
gacagcgagaagaccggcggcgagaagcccatcgacctgatccgcgcgacgcggccgatc
gtgatcgtcgacgagccgcaaagcgtcgacggcggcctcgaagggcgcgggcgcgaagcg
ctcgccgcgatggcgccgctctgcacgctgcgctattcggccacgcacgtcgaccgccat
cacatggtgtaccggctcgatgcggtcgacgcgtacgagcgcaagctcgtcaagcagatc
gagatcgcgtcggcgatcgtcgaggatgcgcacaacaagccgtacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagcgcgcgcgtcgagctcgacgtcgcgacggcggcc
ggcgtgaagcgccagatcgtgtcggcgaccgacggcgacgatctcgaacgcctgaccaag
cgcgcgctgtacgcggggctgcggatcggcgaagtgcatgcggtcaagggcgccgaatac
gtggagctgcgccatccggaaggcgaggcgttcctgtcgctcggcgaggcgttcggcgac
atcgacacgctggccgtacagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggagctgcgcctcgccgagcgcggcgtgaaggtgttgtcgttgttcttcgtcgactcg
gtcgaacgctatcgccgctatgacgagaacggcatgccggtgaagggcgactacgcgctg
atcttcgaagaggaatatgcgcgcgcggcgcgcgtgccggcctaccgtgcgctgttcgac
ggcgtcgacgtcgcgctggaagtcgagcgtgcgcacaacggctacttctcgatcgaccgc
aagggcggctggaccgacacgagcgaaagcagcgcggcggcccgggagaacgcggagcgt
gcttacggcctcatcatgcgcgagaaggaagcgctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaacccgaacgtgttccagatc
tgcacgctgcgcgacatccagaccgaacgcgagcgccgccagacgctcggccgcgggctg
cgcctcgcggtcgaccaggacggcgaacgcgtgcgcgacgcgggcgtgaacacgctcacc
gtgatcgcgaccgagcgctacgagtcgttcgccgagaacctgcagaaggaaatcgaggcc
gatacgggcattcgtttcgggatcgtcgaggaacaccagttcgcggcgctgccggtgcag
gaagacggcggtcccgcgcatgcgctcggcatcgagctgtcgcgcgtgctgtggaaccat
ctgcacgagcagggctacgtcgacgcgcagggcaaggtgctcgaccggctgaaggatgcg
ctgcgccggagcgcgctcgtgctgccggacgcgttcgagccgctgcgcgcgccgatcgtc
gcgacgctgcgcaagctgtcgggccgcttcgcggtgcgcaatgccgacgagcgccgcgcg
atcgcgttgcggcgcgatgcatcgggcaaggccgtcgtgttcggcgaggatttccgcgcg
ttgtgggaccgcatccgtcatcgcaccgtgtaccgcgtcgagttcgacaacgcgaagctg
gtgcgcgactgcacggccgcgttgcgcgacgcgccggacatcgcacgggcgcggctgcag
tggcgcaaggccgagatcgacatcggcaaggccggcatcgaggcgatcgaggtggccggc
gccggcacggtgctgctcgacgaaggcgagttgccgctgcccgacctgctcaccgagctg
caggaccgcacgcagctcacgcgccgttcgcttgcgacgatcctcgccgacagcggccgg
ctcgacgatttccgcgtgaatccgcagcagttcatcgcggtcgcggccgatgcgatcaac
cgctgcaagcggctcgcgctcgtcgcgggcatcgcgtaccgcaagctcggcgagcgccac
gtgcatgcgctcgaatcgttcgagagcgaagcgctgaccggctacctgcgcaacctgcgg
ccggacgcgcgcaagtcgatccacgaagcggtcgtgtgcgagacggacgccgagcgcgcg
ttcgccgatgcgctcgaagcgcacgacggcgtgaagctgtacgcgaagctgccggcgtgg
ttccgcgtgcagacgccgctcggcagctatcaccccgactgggccgtgctcgcggaacag
gacggcggcgagcggctgtacttcgtcgtcgatacgccgaatgccgatggccacgtgccg
agcgagcacgaacgcgcgaagctcgcgtgcggcgaagcgcatttccgcgcgctggtcgat
ggcgacggcgcggcgcgcttcgtgcgggtcacgcaggccgatgcgttgttcgagcctgcg
gcgccgacggcgggcgcggggcgctga

DBGET integrated database retrieval system