KEGG   Burkholderia cenocepacia AU1054: Bcen_0072Help
Entry
Bcen_0072         CDS       T00363                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bcen_0072
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcen_0072
Enzymes [BR:bcn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Bcen_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:73226..74773
Genome map
AA seq 515 aa AA seqDB search
MSAARSSHPAHQQIAAALAWLRQHVAPTAQLHADTRSLEAGDVFVAYAVDGADNRAFMAD
AVARGAAAVLYQPEGLAHAPAAPAVPVALAVPALDQLAGEIASGWYGDPSDSLLAVGVTG
TNGKTSCTQWIATALTALHQPCAVIGTLGTGMPGQLVPTGFTTPDAPQLQRSLAQLRDAG
AQAVAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHGTFDAYEAAKAKLFAWRGLRA
AVINRDDAAGRRLLEKLAGRVRTIAYGIGDAPAPDADRELVALDVRATATGTAFRLRSSW
GDANVEVGTLGTFNVSNLLAVLGALLAADVPFDAALAEIERLESVNGRMQRLGGRLQNDE
PLVVIDYAHTPDALEKTLDALRPIAAARGGRLVCMFGCGGDRDATKRPLMGAIAERLADE
VVVTSDNPRSEDPQHIIDQVVAGMTAPDRARRIEDRASAILQAVRGAAREDVVVLAGKGH
EATQEIMGKKRTFSDQDHARLALAARATHGKGGAE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcccgcagttcccatccggcgcatcagcagatcgcagcggcgcttgcgtgg
ctgcgtcagcatgtggcccccacggcgcaactgcatgccgacacgcgcagcctcgaggct
ggcgacgtgttcgtcgcgtatgcggtcgacggggcagataaccgcgctttcatggcggat
gccgtcgcacgcggtgcggccgccgtgctgtatcagccggaagggctggcccacgcaccg
gccgcgccggccgtacccgtcgcgctggcggtgccggcgctcgaccagctcgccggcgag
atcgccagcggttggtacggcgacccgagcgacagcttgctggcggtcggtgtcacgggc
acgaacggcaagacgtcgtgcacgcaatggatcgccaccgcgctgacggcgctgcaccag
ccgtgcgcggtgatcggcacgctcggcaccgggatgcccggtcagctcgtgccgaccggc
ttcacgacgcccgacgcgccgcaacttcagcgcagcctcgcgcaattgcgcgacgcgggt
gcacaggcggtggcgatggaggtgtcgtcgcacgcgctgcatcaggggcgcgtgaacggg
acggcgttcgacatcgcggtgtttacgaacctcacgcaggatcacctcgactatcacggc
acgttcgatgcgtacgaggccgcgaaggcgaagctgttcgcgtggcgcggcttgcgcgcg
gcggtgatcaaccgcgacgatgcggctggccgccgcctgctggagaagctggccggtcgc
gtgcgcacgatcgcgtacgggatcggcgatgcaccggcgcccgacgccgatcgcgaactg
gtcgcgctcgacgtgcgcgccaccgcgacgggtaccgcattccgcctgcgttcgtcgtgg
ggcgacgcgaacgtcgaggtcggcacgctcggcacgttcaacgtcagcaacctgctcgcg
gtgctcggcgcgctgctcgcggccgacgtgccgtttgacgcggcactcgccgagatcgag
cggctcgagtcggtcaacggccggatgcagcggctcggcggccggttgcagaacgacgag
ccgctcgtcgtgatcgactacgcgcacacgcccgacgcgctcgaaaagacgctcgacgcg
ctgcgcccgatcgctgcggcgcgcggcggccggctcgtttgcatgttcggctgcggcggc
gatcgcgatgcgacgaagcgtccgctgatgggcgcgattgcggagcggctcgccgacgaa
gtcgtcgtcacgagcgacaacccacgcagcgaagatccgcagcacatcatcgaccaggtc
gtcgcgggcatgaccgcgcctgatcgcgcacgccgtatcgaggatcgcgcgagcgcgatc
ctgcaggcggtgcggggcgccgcacgcgaggatgtcgtcgtgctggccggcaagggccac
gaggccacgcaggaaatcatgggcaagaagcgtacgttctccgaccaggatcacgcgcgg
ctcgcgctcgcagcgcgcgcgacgcacggcaagggaggcgccgaatga

DBGET integrated database retrieval system