KEGG   Burkholderia cenocepacia AU1054: Bcen_0149Help
Entry
Bcen_0149         CDS       T00363                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bcen_0149
Transfer RNA biogenesis [BR:bcn03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bcen_0149
 Prokaryotic Type
    Bcen_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:156074..156505
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYAREAVPADVAASGLDTIPTASLPRE
AVTTLGLIGAGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTGDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcttacgcacgggaggccgtt
ccggccgacgtggctgccagcgggctcgatacgatcccgactgccagtcttccgcgcgag
gccgtgaccacgctgggcctgatcggcgccggcggcccctatccgtacgagaaagacggc
gtcgtattcggcaatcgcgagcgaatcctgccgaaggcgaagcgcggctattaccatgag
tacacggtgccgacgccgcgtgcgcgcaatcgcggcgcgcgccggatcgtctgtggcggg
ccgttgcgccggatcgacaactgttattacacgggcgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system