KEGG   Burkholderia cenocepacia AU1054: Bcen_0414Help
Entry
Bcen_0414         CDS       T00363                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_0414
   00030 Pentose phosphate pathway
    Bcen_0414
   00051 Fructose and mannose metabolism
    Bcen_0414
   00052 Galactose metabolism
    Bcen_0414
   00500 Starch and sucrose metabolism
    Bcen_0414
   00520 Amino sugar and nucleotide sugar metabolism
    Bcen_0414
  Nucleotide metabolism
   00230 Purine metabolism
    Bcen_0414
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcen_0414
Enzymes [BR:bcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bcen_0414
    5.4.2.8  phosphomannomutase
     Bcen_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:458062..459531
Genome map
AA seq 489 aa AA seqDB search
MRGTRERRPAQARQFSMHATERRESMISQSIFKAYDIRGVVGKTLDVDTARGIGRAFGSE
VRAQGGDAVVVARDGRLSGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAANVPLALKG
GERRVDSCIVVTGSHNPPDYNGFKMVLRGAAIYGEQIQALYRRIVDERFESGSGTYEQID
VADQYIARIVGDVKLARPLKIVVDAGNGVAGPLATRLFKALGCELVERFTDIDGTFPNHH
PDPAHPENLQDVIQALKDTDAELGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSR
NPGAQIIYDVKCTRHLAQWVKSKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKD
RWYGFDDGLYTGARLLEILAKTADPSALLNSLPDAMSTPELQLWLDEGENFRLIEQLQKE
AKFDGADEVVTIDGLRVEYPDGFGLARSSNTTPVVVMRFEAETQEGLKRIQEDFRRVLTA
AKPDVKLPF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcacccgtgagcggcggcccgcgcaagccagacaattttccatgcacgcaact
gagagaagagaatcgatgatctcccaatccatcttcaaggcatatgacattcgtggcgtg
gtcggcaagacactcgacgtcgacacggcgcgcggaatcggccgggcattcggcagcgaa
gtccgtgcgcagggcggcgatgcggtcgtcgtcgcgcgcgacggccgcctgtccgggccg
gaactggtcggcgcgctggccgacggcctgcgtgcggccggggtcgacgtcgtcgacgtc
ggcatggtgccgacgccggtcggttatttcgcggcgaacgtgccgctggcgctgaagggc
ggcgagcgccgcgtcgattcgtgcatcgtcgtcacgggcagtcacaatccgcccgactac
aacggcttcaagatggtgctgcgcggcgccgcgatctacggcgagcagatccaggcgctg
taccgccgcatcgtcgacgagcggttcgagtccggcagcggcacctatgagcagatcgac
gtcgcggatcaatacatcgcgcgcatcgtcggcgacgtgaagctcgcgcggccgctgaag
atcgtggtcgacgccggcaacggcgtcgcaggccccctcgcgacgcgcctgttcaaggcg
ctcggctgcgaactcgtcgagcgcttcaccgacatcgacggcacgttcccgaaccatcac
cccgatcccgcccacccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgat
gcggaactcggcttcgcgttcgacggcgacggcgaccgcctgggcgtcgtcacgaaggac
ggccagatcatctatccggaccgccagctgatgctgttcgcggaagaagtgctgtcgcgc
aacccgggcgcgcagatcatctacgacgtgaagtgcacgcgccacctcgcgcagtgggtg
aagtcgaagggcggcgagccgctgatgtggaagacgggtcactcgctcgtgaaggcgaag
ctgcgcgagacgggtgcgccgctcgccggcgaaatgagcggccacgtgttcttcaaggat
cgctggtacggcttcgacgacggcctgtacaccggtgcgcgcctgctcgagattctcgcg
aagacggccgatccgagcgcgctgctcaacagcctgccggacgcgatgagcacgccggaa
ctgcagctctggctcgacgaaggcgagaatttccgcctgatcgagcagttgcagaaagag
gcgaagttcgacggcgccgatgaagtcgtgacgatcgacggcctgcgtgtcgagtacccg
gacggcttcggcctcgcgcgttcgtcgaacacgacgccggtcgtcgtgatgcgcttcgag
gccgagacgcaggaagggctcaagcgcatccaggaagacttccgccgcgtgctgacggcc
gcgaagccggacgtcaagctgccgttctga

DBGET integrated database retrieval system