KEGG   Burkholderia cenocepacia AU1054: Bcen_0603Help
Entry
Bcen_0603         CDS       T00363                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcen_0603
   00670 One carbon pool by folate
    Bcen_0603
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bcen_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(649319..649879)
Genome map
AA seq 186 aa AA seqDB search
MRATVPVKSAPFRFPSSPTFMTTLTLIVARARNGIIGRDNQLPWKLPEDLAFFKRTTMGA
PIVMGRKTHESIGRPLPGRRNIVVTRDATRRFEGCDTVTSLADALALAARDGVPEAFLIG
GAQLYAEGLMLADKLIVTEIDADFDGGASFPAPDAAHWQEVSRDAHQAAAPNTFGYAFVV
YTRKRD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccaccgttccggtaaaatcggccccattccgtttcccctcttccccgaccttc
atgacgacgttgaccctgatcgtcgcgcgtgcccgcaacggcatcatcggccgcgacaac
cagttgccctggaaacttcccgaggatctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacccacgagtcgatcggccggccgctgccgggccgccgc
aacatcgtcgtcacgcgcgacgccacgcgccgtttcgaaggctgcgacacggtcacgtcg
ctcgccgatgcgctggcgctcgccgcgcgcgacggggtgcccgaggcattcctgatcggc
ggtgcacaactctatgcggaaggtctcatgctcgccgacaagctgatcgtcaccgagatc
gacgccgacttcgacggcggcgcatcgttcccggcgcccgatgccgcacactggcaggaa
gtctcgcgcgacgcgcatcaggctgccgcgcccaacacgttcggctatgcgttcgtcgtc
tacacgcgcaagcgcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system