KEGG   Burkholderia cenocepacia AU1054: Bcen_0817Help
Entry
Bcen_0817         CDS       T00363                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:883943..884842
Genome map
AA seq 299 aa AA seqDB search
MLVSDSAVSPFIPAPLQCGRFELTFERPLVMGILNATPDSFSDGGRFLARDDALRQAERM
IADGADLLDIGGESTRPGAPPVPLDEELARVVPLVEALRPFNVPLSIDTYKPAVMRAALA
AGADLINDIWGFRQPGAIDAVRDGNSGLCAMHMLGEPQTMQVGEPDYGDVVTDVRDFLAA
RAEALRDAGVAAERICVDPGFGFGKAVVDDNYALLAALPDTAPARPDGSAYPILAGMSRK
SMLGAVIGGKPPMERVAASVAAAVCAVERGAAIVRVHDVAATVDALKVWNTVRAAARQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgtgtccgattccgctgtgtccccgttcattcccgcgccgctccagtgcggccgc
ttcgaactgacgttcgaacgcccgctcgtgatgggcatcctcaacgccacgcccgattcg
ttctccgacggcggccgcttcctcgcgcgcgacgatgcgctgcgccaggccgagcggatg
atcgccgacggcgcggacctgctcgacatcggcggcgaatcgacgcgccccggtgcgccg
ccggtgccgctcgacgaggagctcgcgcgcgtggttccgctcgtcgaggcgctgcggccg
ttcaacgtgccgctgtcgatcgatacctacaagccggccgtgatgcgcgcggcgctggcc
gccggcgcggatctgatcaacgacatatgggggttccgccagccgggcgcgatcgatgcg
gtgcgcgacggcaacagcggcctgtgcgcgatgcacatgctcggcgagccgcagacgatg
caggtcggcgagcccgactacggcgacgtcgtgaccgacgtccgcgattttctcgctgcg
cgcgccgaggcgctgcgcgacgcgggggtggcggcggagcgcatctgcgtcgaccccggc
ttcgggttcggcaaggcggtcgtcgacgacaactatgcgctgctcgccgcgttgccggac
acggcgcccgcgcgccccgacgggagcgcttatccgattctcgcgggcatgtcgcgcaag
tcgatgctcggtgcggtgatcggcggcaagccgccgatggagcgcgtcgcggcgagcgtg
gcggccgcggtgtgcgcggtcgagcggggcgccgcgatcgtgcgcgtgcacgacgtcgcg
gcgacggtcgatgcgctaaaagtatggaataccgtgcgcgcagccgcacggcaacgataa

DBGET integrated database retrieval system