KEGG   Burkholderia cenocepacia AU1054: Bcen_0958Help
Entry
Bcen_0958         CDS       T00363                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcen_0958
   00052 Galactose metabolism
    Bcen_0958
   00500 Starch and sucrose metabolism
    Bcen_0958
   00520 Amino sugar and nucleotide sugar metabolism
    Bcen_0958
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcen_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(1044930..1045814)
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGNPPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWE
ESIVKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGAEFETYLRTRDGAQPTV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggtattccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgccggtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcgcggccggcattaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggaccacttcgacaagtcgtacgaggtcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgaactcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgcgcggaaaag
ctcgtcgccgacaacccgttcgcggtgatcctcgcggacgacctgctcgacggcaacccg
ccggtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtc
gaagagatcccgccgtcggagacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gagtcgatcgtcaagatgtcggcgatcgtcgagaagccggcgccggaagtcgcgccgtcg
aacctcggcgtggtcggccgctacgtgctgaaaccgcggatcttcgatcacctgcgtgcg
ctgaagccgggcgcgggcggcgaactgcagctcaccgatgcgatccaggcgctgctcgcc
gacgaacaggtgctggcctacaagtaccagggcacgcgctacgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaattcgcgctgcgccacccggaagtcggtgcggaattc
gagacgtacctgcgcacccgcgacggcgcccaaccgaccgtctga

DBGET integrated database retrieval system