KEGG   Burkholderia cenocepacia AU1054: Bcen_1029Help
Entry
Bcen_1029         CDS       T00363                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bcn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bcn00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bcn00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:1124088..1125368
Genome map
AA seq 426 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAAPAAQPAAATASSSA
AASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALP
EVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK
YKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL
VVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN
PPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagttgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtggccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgccgaagccgcggcaggcgccgccgaagtcaagccggcagccgcg
cctgcagcagcagccgcaccggccgctcagccggcagccgcaacggcatcgagctcggcc
gccgcatcgccggccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtc
gcaggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggcagcaggcagcgca
ccgaaggctgctccggccgccgcaccggcgaagaccgccgccgcgaagccggcgctgccg
gaagtgaaggtgccggcgtcggcagcgacctggctgaacgaccgcccggaacagcgtgtg
ccgatgtcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaac
gcgatcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaag
tacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtg
aaggcggccgtccatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaac
gacatcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtcgtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatc
gccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggt
acgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaac
ccgccgcaatcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaac
ggccagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatc
gacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggca
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system