KEGG   Burkholderia cenocepacia AU1054: Bcen_1178Help
Entry
Bcen_1178         CDS       T00363                                 

Definition
magnesium chelatase, ChlI subunit (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:1300258..1301334
Genome map
AA seq 358 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQDALQQALLLVAIDPSLGGVLVSGPRGTAKSTAARGLAEL
LPEGQFVTLPLSASDEQVTGTLDLAHALAENGVRFRPGLLARAHLGVLYVDEVNLLADGL
VDTLLDVAASGVNIVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHAAAQRELADRIHAARARLPALDFDDAVHAHVSALC
IDAAVDGLRADLVMLRAARALAALEQADAVTVSHVARVAEAVLRHRRHAGPPPSQQSSQQ
GGERDDRSRSDTPRQPDKRQDDTKADASPSQGDWGYLPPEPAGLRDVKSVVPLPLKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgaccacgccccgcgcccgcgcggtttttccgtttgcggcgctcgtcgcg
caggacgcgttgcagcaggcgctgctgcttgtcgcgatcgacccgtcgctcggcggcgtg
ctcgtcagcggcccgcgcggcaccgcgaaatcgacggccgcgcgcggcctggcggagctg
ctgccggaagggcagttcgtcacgctgccgctatcggcgagcgacgagcaggtgacgggc
acgctcgatctcgcgcatgcgctggccgaaaacggcgtgcgttttcgacccggcctgctg
gcgcgcgcgcatctcggcgtgctgtacgtcgacgaagtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacatcgtcgagcgcgatggcgtg
tcgcacgcgcacgatgcgcgcttcgtgctggtcggcacgatgaaccccgaggaaggcgag
ttgcggccgcaactgctcgatcgcttcgggctgatggtcgagctggagaactgcttcgac
gccgcccagcgcgagcggatcgtgaaggcgcgactcgcgttcgatctcgatccggatgcg
tttcgcgcgcgtcacgcggcggcccagcgggaactcgcggaccgcattcatgcggcgcgc
gcgcggctgccggcgctcgatttcgacgatgcggtccatgcgcacgtcagcgcactgtgc
atcgacgcggccgtcgacgggttgcgggccgatctcgtgatgctgcgcgccgcgcgtgcg
ctggccgcactggaacaggccgacgcggtgacggtgtcgcatgtggcgcgcgtggccgaa
gccgtgctgcggcaccggcgccatgcggggccgccgccgtcgcagcagtcgtcgcaacaa
gggggagagcgcgacgatcgttcgcggtcggacacaccacggcagcctgacaagcgacag
gacgacacgaaggccgacgcgtccccatcgcaaggcgactggggctacttgccgcccgaa
ccggccgggctgcgcgacgtgaaaagcgtcgtgccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system