KEGG   Burkholderia cenocepacia AU1054: Bcen_1335Help
Entry
Bcen_1335         CDS       T00363                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcen_1335
Enzymes [BR:bcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bcen_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
1:1474457..1476679
Genome map
AA seq 740 aa AA seqDB search
MTTDVPIAALARAAGLQPDWTDAGGVARRVDDDALVALVDALGWPCGTAIQRVDSAAALA
DANASPPRLVTGDAGLPLTLPATIAPPGARFRISLETGGHVDGRVGGAGEHGTLPPLAMP
GYHALDIGEQRIGLAIAPPRARPFDALARAHDGGRWGIAAQLYSLRRTGDDGAGDYTALA
RLAAQAARHGAQAVAISPTHAGYPALPAHDSPYSPSSRRWHNVAYLDCDAVPGADAAHRP
SAATADAALIDWPSVLPTKLRRLRACFDAWRASDDPSRDTHQRFRAAGGAALDAHARFDA
LQAFCIEHGIGADWRQWPSQWRMSGSAEVDAFAHEHADTIAFHTFLQWCASRALGDAQHA
ARGAGMATGLIADLAVGSDQAGSDAWAHGTTLLRGVSLGAPPDLFNAAGQAWGVTTWTPD
ALRADGFMPFIDLLRAAFAHAGGIRIDHVLGFARMWIVPDGGSPRSGAYLHYPLDDLVRL
VALEAARHRAIAIGEDLGTVPAGLRERLGAQGVAGMRVLWFERDADGAFRPPAAWDRDAI
AMTSTHDLPTVAGWWRGVDLGWRRVAAEAAAAKRRDEAQPPRDVAAPAPDDASAHDSDAI
VQSMAFGHDTVQRPDSNHSTPPPPPELLAAHAERATERAALWHALQHAGCAPADAAVPPA
NMPPVNAILGYVASSPSPLALLPLEDLLALDAQPNLPGPPCGHPNWRQRLPRTIDALFDA
DVRTRIAAVVHARRSRRHGP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtcccgatcgcggcgctcgcccgtgcggccggcctgcaacccgactgg
accgacgcgggcggcgtcgcacggcgcgtggacgacgacgcgctggtcgcgctcgtcgat
gcgctcggctggccgtgcggcacggcgatccagcgggtcgacagcgcggccgcgctcgcc
gatgcgaacgcgtcaccgccgcgcctcgtgaccggcgacgccggcctgccgctgacgctg
cccgcgaccatcgcgccgccgggcgcgcgcttcaggatctcgctcgaaaccggcgggcac
gtggacggccgggtgggcggcgcgggcgaacacggcacgctgccgccgctcgcgatgccc
ggttatcacgcgctcgacatcggcgagcagcgcatcgggctcgcgattgcgccgccgcgg
gcacggccattcgacgcgctcgcccgtgcgcacgacggaggccgctggggcatcgcggcg
cagctctacagcctgcgccgcaccggcgacgatggcgcgggcgattacacggcgcttgcg
cggctcgccgcacaggcggcgcgacacggcgcgcaggcggtggcgatcagcccgacgcat
gccggctatccggcgcttcccgcgcacgacagcccgtattcgccgtcgtcgcggcgctgg
cacaacgtcgcgtatctcgactgcgacgcggtgccgggcgccgacgcggcacatcgccca
tccgctgccacggccgacgccgcgctgatcgactggcccagcgtgctgccgacgaagctg
cggcgcctgcgtgcgtgcttcgacgcatggcgcgcgagcgacgacccgtcgcgcgacacg
caccagcggtttcgcgcggcgggcggcgcggcgctcgacgcgcatgcgcgcttcgatgcg
ctgcaggcgttctgcatcgagcacgggatcggcgcggactggcggcagtggccgtcgcaa
tggcgcatgtcggggtcggcggaagtcgacgcgttcgcgcatgagcatgccgacacgatc
gcgttccacaccttcctccaatggtgcgcgtcgcgcgcgctcggcgacgcgcagcacgcc
gcgcgcggcgcgggcatggcgaccgggctgatcgccgatctcgcggtcggctccgatcag
gccggcagcgacgcgtgggcgcacggcacgacgctgctgcgcggtgtatcgctcggcgcg
ccgcccgacctgttcaatgcggccggtcaggcgtggggcgtgacgacgtggacgcccgac
gcgctgcgtgcggacggcttcatgccgttcatcgacctgctgcgcgccgcgttcgcgcac
gccggcggcatccgcatcgaccacgtgctcggcttcgcgcgaatgtggatcgtgccggac
ggtggctcgccgcgcagcggcgcgtacctgcactatccgctcgacgatctggtgcggctc
gtcgcgctcgaggcggcgcgccatcgcgcgatcgcgatcggcgaggatctgggcaccgtg
ccggccgggttgcgcgaacggctcggcgcgcagggtgtcgcgggcatgcgcgtgctgtgg
ttcgagcgcgatgcggatggcgcgttccggccgcccgccgcgtgggatcgcgacgcgatc
gcgatgacctcgacgcacgatttgccgaccgtggccggctggtggcgcggcgtcgatctc
ggatggcggcgcgtcgcagccgaggccgcagccgcgaagcgacgcgacgaagcgcaacca
ccgcgcgatgtcgccgccccggcgccggacgacgcgagcgcgcacgattcggacgcaatc
gtgcaaagcatggcgttcgggcacgacaccgtgcagcgccccgattcgaatcactcgacg
cccccgccgcctcccgaactgcttgccgctcacgcggaacgcgccaccgagcgcgcggcg
ctgtggcacgcgctgcagcacgcaggctgcgcgccggccgacgccgcggtgccgccggct
aacatgccgccggtgaacgcgatcctcggctacgtcgcgagcagcccgtcgccgctcgcg
ctgctgccgctcgaggatctgctcgccctcgacgcgcagccgaacctgccggggccgccg
tgcggccatccgaactggcggcagcggctgccgcgcacgatcgatgcgctgttcgacgcc
gacgtgcgcacgcgcatcgcggccgtcgtgcacgcgcgccgctcgcggaggcatggccca
tga

DBGET integrated database retrieval system