KEGG   Burkholderia cenocepacia AU1054: Bcen_1539Help
Entry
Bcen_1539         CDS       T00363                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcen_1539
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcen_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1711800..1712762
Genome map
AA seq 320 aa AA seqDB search
MRAAPHTKEETQMETIAVIGSNMVDLVTYVARMPARGETLEAPNFELGCGGKGANQAVAA
ARLGARVVMVTKVGDDVFADNTIRNFEREGIDTTHVRKVAGVPSGVAPIFVEPDSSNSIL
IVKGANRHLQPTDIDAAAPMLAECALIVLQLEIELDTVYHAIEFGARHGIPVLLNPAPAV
ADLDFERIRSVEFFVPNETELAIVSGLPVDSRESATRAAEALVARGLKHVLVTLGSNGSL
LVSRDGVHHVPGVPVDARDTTGAGDAYIGCFARCYAASRDAVDAMRYASAYAAHSVTGLG
TQKSYADAATFERFLRDAGF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgcggcgccccataccaaggaagagacgcagatggagacaatcgccgtcatcggc
agcaacatggtcgacctcgtgacctatgtcgcgcgcatgcccgcccggggcgagacgctg
gaggccccgaacttcgagctcggctgcggcggcaagggcgcgaaccaggccgtcgcggcc
gcgcgcctcggcgcgcgcgtcgtgatggtcacgaaggtcggcgacgacgtgttcgccgac
aacacgatccgcaacttcgaacgcgaaggcatcgacaccacgcacgtgcgcaaggtcgcc
ggcgtgccgagcggcgtcgcgccgatcttcgtcgagcccgattcgagcaacagcatcctg
atcgtcaagggcgcgaaccgccacctgcagccgaccgacatcgacgcggccgcgccgatg
ctcgccgaatgcgcgctgatcgtgctgcagctcgagatcgaactcgacaccgtctatcac
gcgatcgaattcggcgcacggcacggcattccggtgctgctgaatcccgcgccggcggtc
gccgacctcgatttcgaacgcatccgttccgtcgaattcttcgtgccgaacgaaaccgag
ctcgcgatcgtgtcgggcctgccggtcgattcgcgcgagagcgcgacccgcgccgccgaa
gcgctggtcgcacgcgggctcaagcacgtgctcgtcacgctcggcagcaacggttcgctg
ctggtgtcgcgcgacggcgtgcatcacgtgccgggcgtcccggtcgacgcgcgcgacacg
acgggcgccggcgacgcgtacatcggctgcttcgcgcgctgctatgccgcgtcgcgcgac
gcggtcgatgcgatgcgctacgcgtccgcgtacgccgcgcattcggtcacgggcctcggc
acgcagaaatcgtacgccgacgccgcgacgttcgaacgcttcctccgcgacgccggcttc
tga

DBGET integrated database retrieval system