KEGG   Burkholderia cenocepacia AU1054: Bcen_1639Help
Entry
Bcen_1639         CDS       T00363                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen_1639
   01230 Biosynthesis of amino acids
    Bcen_1639
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_1639
   00051 Fructose and mannose metabolism
    Bcen_1639
   00562 Inositol phosphate metabolism
    Bcen_1639
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcen_1639
Enzymes [BR:bcn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcen_1639
Exosome [BR:bcn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcen_1639
  Exosomal proteins of bladder cancer cells
   Bcen_1639
  Exosomal proteins of melanoma cells
   Bcen_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(1819416..1820171)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGTVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRA
LAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcgggcacggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagcttggcggt
ggccgtgtcgcgttcggtgcacaggacgtgtccgcacacgagcaaggcgcgttcaccggt
gaggtggcggcggcgatggtggcggagttcggcgcgcggtatgcgatcgtcggccactcg
gagcgtcgcgcgtatcacggcgaaagcaacgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggccggcctcgtgccggtcgtgtgtgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgtatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcatgcgttcctgcggacgcgtctcgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcaaccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system