KEGG   Burkholderia cenocepacia AU1054: Bcen_2038Help
Entry
Bcen_2038         CDS       T00363                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00020  Citrate cycle (TCA cycle)
bcn00640  Propanoate metabolism
bcn00660  C5-Branched dibasic acid metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Module
bcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen_2038
   00640 Propanoate metabolism
    Bcen_2038
   00660 C5-Branched dibasic acid metabolism
    Bcen_2038
Enzymes [BR:bcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcen_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C Dockerin_1
Motif
Other DBs
NCBI-ProteinID: ABF76939
JGI: Bcen2038
UniProt: Q1BTW6
Position
1:complement(2250824..2251990)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcggaagagctcggcggc
ccggtatgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaaccgtctgatgatcgaggaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgaccgcatctcgcagaag
atcgtgctgatgggctcgagcgaaggcggcatggacatcgaagaagtcgccgagaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctggacgcgcaggcc
gacgacctcgccgcgaagatcggcgtgccggctgcgtcgattccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggccgaaatcaacccg
ctgaacgtctccggcgacggcaaggtcaccgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctcgtgaacggcgcgggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggaggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctggtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctcggcggacagcatggaagaggctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system