KEGG   Burkholderia cenocepacia AU1054: Bcen_2187Help
Entry
Bcen_2187         CDS       T00363                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00900  Terpenoid backbone biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen_2187
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bcen_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABF77088
JGI: Bcen2187
UniProt: Q1BTG7
Position
1:2413493..2414374
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTRRDDGRVARV
TDVPGVPEESDLVVRAANLLKAHTDTAHGVDIEIDKILPMGAGLGGGSSDAATTLLALNR
LWQLDLPRAELQSLAVKLGADVPFFIFGKNAFAEGIGEELAEVELPTRWFLVVTPRVHVP
TAEIFSDELLTRDTKPVTIADFLAQQTSDAEWPDSFGRNDMQEVVTRKYAEVAQVVKWLY
DVTPARMTGSGASVFAAFHSKHEAEAAKAKLPASWNGAVAESLNEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgcctggcgcccgcgaaactcaacctgttc
ctgcacatcaccggccgtcgtccgaacggctatcacgatctgcagagcgtattccagctg
ctgaactggggcgacacgctgcacttcacgcggcgcgacgacggccgcgtcgcacgcgtc
accgacgtgcccggcgtgcccgaggaaagcgatctcgtcgtgcgcgcggccaacctgctg
aaagcgcatacggataccgcgcacggcgtcgacatcgagatcgacaagatcctgccgatg
ggcgccggcctcggcggcggcagctccgacgcggcgacgacgctgctcgcgctgaaccgc
ctgtggcaactcgatttgccgcgcgccgagcttcagtcgctcgcggtcaaactcggcgcc
gacgtcccgttttttatttttggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtagaattgccgactcgctggttcttggttgtgacgccacgcgttcatgtcccg
accgctgaaatattttcagatgagttgttgacaagagatacgaagcccgtcacaattgct
gactttcttgcacagcaaaccagcgatgcggaatggccagatagcttcggccggaacgat
atgcaggaagttgtaacaaggaagtacgcggaagttgcgcaggtggtcaaatggttgtat
gatgtgacccccgcgaggatgaccggctccggagcaagcgtgtttgcagcgtttcacagc
aagcacgaggcagaagcggcgaaagccaaactgcccgccagttggaatggcgcagttgcc
gagagtctgaacgagcatccgctcttcgctttcgcgtcatga

DBGET integrated database retrieval system